Gene/Proteome Database (LMPD)

LMPD ID
LMP003473
Gene ID
9653
Species
Homo sapiens (Human)
Gene Name
heparan sulfate 2-O-sulfotransferase 1
Gene Symbol
HS2ST1
Synonyms
dJ604K5.2
Alternate Names
heparan sulfate 2-O-sulfotransferase 1; 2OST; 2-O-sulfotransferase
Chromosome
1
Map Location
1p22.3
EC Number
2.8.2.-
Summary
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq, Aug 2008]
Orthologs
View orthologs and multiple alignments for HS2ST1

Proteins

heparan sulfate 2-O-sulfotransferase 1 isoform 1
Refseq ID NP_036394
Protein GI 6912420
UniProt ID Q7LGA3
mRNA ID NM_012262
Length 356
RefSeq Status REVIEWED
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEKIYPKSN
heparan sulfate 2-O-sulfotransferase 1 isoform 2
Refseq ID NP_001127964
Protein GI 197382758
UniProt ID Q7LGA3
mRNA ID NM_001134492
Length 229
RefSeq Status REVIEWED
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

Gene Information

Entrez Gene ID
9653
Gene Name
heparan sulfate 2-O-sulfotransferase 1
Gene Symbol
HS2ST1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 TAS:Reactome C Golgi membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0008146 IEA:InterPro F sulfotransferase activity
GO:0005975 TAS:Reactome P carbohydrate metabolic process
GO:0006024 TAS:Reactome P glycosaminoglycan biosynthetic process
GO:0030203 TAS:Reactome P glycosaminoglycan metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121315 Glycosaminoglycan metabolism
REACT_121248 HS-GAG biosynthesis
REACT_121314 Heparan sulfate/heparin (HS-GAG) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR007734 Heparan sulphate 2-O-sulfotransferase
IPR027417 P-loop containing nucleoside triphosphate hydrolase
IPR005331 Sulfotransferase

UniProt Annotations

Entry Information

Gene Name
heparan sulfate 2-O-sulfotransferase 1
Protein Entry
HS2ST_HUMAN
UniProt ID
Q7LGA3
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q7LGA3-1; Sequence=Displayed; Name=2; IsoId=Q7LGA3-2; Sequence=VSP_014062, VSP_014064; Note=No experimental confirmation available.; Name=3; IsoId=Q7LGA3-3; Sequence=VSP_014063; Note=No experimental confirmation available.;
Function Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high- affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues (By similarity).
Ptm N-glycosylated.
Sequence Caution Sequence=BAA32293.2; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the sulfotransferase 3 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Subunit Homotrimer. Interacts with the C5-epimerase GLCE (By similarity).

Identical and Related Proteins

Unique RefSeq proteins for LMP003473 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6912420 RefSeq NP_036394 356 heparan sulfate 2-O-sulfotransferase 1 isoform 1
197382758 RefSeq NP_001127964 229 heparan sulfate 2-O-sulfotransferase 1 isoform 2

Identical Sequences to LMP003473 proteins

Reference Database Accession Length Protein Name
GI:197382758 GenBank AAH25384.1 229 HS2ST1 protein [Homo sapiens]
GI:197382758 GenBank AAH25990.1 229 HS2ST1 protein [Homo sapiens]
GI:197382758 GenBank AAI08736.1 229 HS2ST1 protein [Homo sapiens]
GI:6912420 GenBank ADT47379.1 356 Sequence 1040 from patent US 7842466
GI:197382758 GenBank ADZ15840.1 229 heparan sulfate 2-O-sulfotransferase 1, partial [synthetic construct]
GI:6912420 GenBank JAA04789.1 356 heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes]
GI:6912420 GenBank JAA16704.1 356 heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes]
GI:6912420 GenBank JAA31602.1 356 heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes]
GI:6912420 GenBank JAA38645.1 356 heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes]
GI:197382758 GenBank AIC50412.1 229 HS2ST1, partial [synthetic construct]
GI:6912420 RefSeq XP_003805356.1 356 PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Pan paniscus]

Related Sequences to LMP003473 proteins

Reference Database Accession Length Protein Name
GI:197382758 DBBJ BAA89250.1 356 heparan sulfate 2-sulfotransferase [Homo sapiens]
GI:6912420 DBBJ BAA32293.2 362 KIAA0448 protein, partial [Homo sapiens]
GI:197382758 DBBJ BAG09742.1 356 heparan sulfate 2-O-sulfotransferase 1, partial [synthetic construct]
GI:197382758 GenBank EAW73171.1 356 heparan sulfate 2-O-sulfotransferase 1, isoform CRA_b [Homo sapiens]
GI:6912420 GenBank EHH50057.1 356 hypothetical protein EGM_00821 [Macaca fascicularis]
GI:6912420 GenBank AFE81012.1 356 heparan sulfate 2-O-sulfotransferase 1 isoform 1 [Macaca mulatta]
GI:6912420 GenBank AFH34770.1 356 heparan sulfate 2-O-sulfotransferase 1 isoform 1 [Macaca mulatta]
GI:197382758 RefSeq NP_036394.1 356 heparan sulfate 2-O-sulfotransferase 1 isoform 1 [Homo sapiens]
GI:197382758 RefSeq XP_524759.2 356 PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Pan troglodytes]
GI:6912420 RefSeq XP_003892199.1 356 PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Papio anubis]
GI:6912420 RefSeq XP_007976253.1 356 PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Chlorocebus sabaeus]
GI:197382758 SwissProt Q7LGA3.1 356 RecName: Full=Heparan sulfate 2-O-sulfotransferase 1; Short=2-O-sulfotransferase; Short=2OST [Homo sapiens]