Gene/Proteome Database (LMPD)
LMPD ID
LMP003473
Gene ID
Species
Homo sapiens (Human)
Gene Name
heparan sulfate 2-O-sulfotransferase 1
Gene Symbol
Synonyms
dJ604K5.2
Alternate Names
heparan sulfate 2-O-sulfotransferase 1; 2OST; 2-O-sulfotransferase
Chromosome
1
Map Location
1p22.3
EC Number
2.8.2.-
Summary
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq, Aug 2008]
Orthologs
Proteins
| heparan sulfate 2-O-sulfotransferase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_036394 |
| Protein GI | 6912420 |
| UniProt ID | Q7LGA3 |
| mRNA ID | NM_012262 |
| Length | 356 |
| RefSeq Status | REVIEWED |
| MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEKIYPKSN | |
| heparan sulfate 2-O-sulfotransferase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001127964 |
| Protein GI | 197382758 |
| UniProt ID | Q7LGA3 |
| mRNA ID | NM_001134492 |
| Length | 229 |
| RefSeq Status | REVIEWED |
| MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW | |
Gene Information
Entrez Gene ID
Gene Name
heparan sulfate 2-O-sulfotransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0008146 | IEA:InterPro | F | sulfotransferase activity |
| GO:0005975 | TAS:Reactome | P | carbohydrate metabolic process |
| GO:0006024 | TAS:Reactome | P | glycosaminoglycan biosynthetic process |
| GO:0030203 | TAS:Reactome | P | glycosaminoglycan metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00534 | Glycosaminoglycan biosynthesis - heparan sulfate / heparin |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121315 | Glycosaminoglycan metabolism |
| REACT_121248 | HS-GAG biosynthesis |
| REACT_121314 | Heparan sulfate/heparin (HS-GAG) metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
heparan sulfate 2-O-sulfotransferase 1
Protein Entry
HS2ST_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q7LGA3-1; Sequence=Displayed; Name=2; IsoId=Q7LGA3-2; Sequence=VSP_014062, VSP_014064; Note=No experimental confirmation available.; Name=3; IsoId=Q7LGA3-3; Sequence=VSP_014063; Note=No experimental confirmation available.; |
| Function | Catalyzes the transfer of sulfate to the C2-position of selected hexuronic acid residues within the maturing heparan sulfate (HS). 2-O-sulfation within HS, particularly of iduronate residues, is essential for HS to participate in a variety of high- affinity ligand-binding interactions and signaling processes. Mediates 2-O-sulfation of both L-iduronyl and D-glucuronyl residues (By similarity). |
| Ptm | N-glycosylated. |
| Sequence Caution | Sequence=BAA32293.2; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the sulfotransferase 3 family. |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
| Subunit | Homotrimer. Interacts with the C5-epimerase GLCE (By similarity). |
Identical and Related Proteins
Unique RefSeq proteins for LMP003473 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6912420 | RefSeq | NP_036394 | 356 | heparan sulfate 2-O-sulfotransferase 1 isoform 1 |
| 197382758 | RefSeq | NP_001127964 | 229 | heparan sulfate 2-O-sulfotransferase 1 isoform 2 |
Identical Sequences to LMP003473 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:197382758 | GenBank | AAH25384.1 | 229 | HS2ST1 protein [Homo sapiens] |
| GI:197382758 | GenBank | AAH25990.1 | 229 | HS2ST1 protein [Homo sapiens] |
| GI:197382758 | GenBank | AAI08736.1 | 229 | HS2ST1 protein [Homo sapiens] |
| GI:6912420 | GenBank | ADT47379.1 | 356 | Sequence 1040 from patent US 7842466 |
| GI:197382758 | GenBank | ADZ15840.1 | 229 | heparan sulfate 2-O-sulfotransferase 1, partial [synthetic construct] |
| GI:6912420 | GenBank | JAA04789.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes] |
| GI:6912420 | GenBank | JAA16704.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes] |
| GI:6912420 | GenBank | JAA31602.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes] |
| GI:6912420 | GenBank | JAA38645.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 [Pan troglodytes] |
| GI:197382758 | GenBank | AIC50412.1 | 229 | HS2ST1, partial [synthetic construct] |
| GI:6912420 | RefSeq | XP_003805356.1 | 356 | PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Pan paniscus] |
Related Sequences to LMP003473 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:197382758 | DBBJ | BAA89250.1 | 356 | heparan sulfate 2-sulfotransferase [Homo sapiens] |
| GI:6912420 | DBBJ | BAA32293.2 | 362 | KIAA0448 protein, partial [Homo sapiens] |
| GI:197382758 | DBBJ | BAG09742.1 | 356 | heparan sulfate 2-O-sulfotransferase 1, partial [synthetic construct] |
| GI:197382758 | GenBank | EAW73171.1 | 356 | heparan sulfate 2-O-sulfotransferase 1, isoform CRA_b [Homo sapiens] |
| GI:6912420 | GenBank | EHH50057.1 | 356 | hypothetical protein EGM_00821 [Macaca fascicularis] |
| GI:6912420 | GenBank | AFE81012.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 isoform 1 [Macaca mulatta] |
| GI:6912420 | GenBank | AFH34770.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 isoform 1 [Macaca mulatta] |
| GI:197382758 | RefSeq | NP_036394.1 | 356 | heparan sulfate 2-O-sulfotransferase 1 isoform 1 [Homo sapiens] |
| GI:197382758 | RefSeq | XP_524759.2 | 356 | PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Pan troglodytes] |
| GI:6912420 | RefSeq | XP_003892199.1 | 356 | PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Papio anubis] |
| GI:6912420 | RefSeq | XP_007976253.1 | 356 | PREDICTED: heparan sulfate 2-O-sulfotransferase 1 isoform X2 [Chlorocebus sabaeus] |
| GI:197382758 | SwissProt | Q7LGA3.1 | 356 | RecName: Full=Heparan sulfate 2-O-sulfotransferase 1; Short=2-O-sulfotransferase; Short=2OST [Homo sapiens] |