Gene/Proteome Database (LMPD)
Proteins
| epididymal-specific lipocalin-8 precursor | |
|---|---|
| Refseq ID | NP_149157 |
| Protein GI | 14994308 |
| UniProt ID | Q924P3 |
| mRNA ID | NM_033145 |
| Length | 175 |
| RefSeq Status | PROVISIONAL |
| MEARLLSNVCGFFLVFLLQAESTRVELVPEKIAGFWKEVAVASDQKLVLKAQRRVEGLFLTFSGGNVTVKAVYNSSGSCVTESSLGSERDTVGEFAFPGNREIHVLDTDYERYTILKLTLLWQGRNFHVLKYFTRSLENEDEPGFWLFREMTADQGLYMLARHGRCAELLKEGLV | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2488 peptide sequence: MEARLLSNVCGFFLVFLLQAES mat_peptide: 23..175 product: Epididymal-specific lipocalin-8 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q924P3.1) calculated_mol_wt: 17396 peptide sequence: TRVELVPEKIAGFWKEVAVASDQKLVLKAQRRVEGLFLTFSGGNVTVKAVYNSSGSCVTESSLGSERDTVGEFAFPGNREIHVLDTDYERYTILKLTLLWQGRNFHVLKYFTRSLENEDEPGFWLFREMTADQGLYMLARHGRCAELLKEGLV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0009725 | IDA:MGI | P | response to hormone |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | May play a role in male fertility. May act as a retinoid carrier protein within the epididymis. |
| Similarity | Belongs to the calycin superfamily. Lipocalin family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000250}. |
| Tissue Specificity | Predominantly expressed in epididymis. {ECO:0000269|PubMed:11181548}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003532 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14994308 | RefSeq | NP_149157 | 175 | epididymal-specific lipocalin-8 precursor |
Identical Sequences to LMP003532 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14994308 | GenBank | AAK58105.1 | 175 | lipocalin precursor [Mus musculus] |
| GI:14994308 | GenBank | AAH48433.1 | 175 | Lipocalin 8 [Mus musculus] |
| GI:14994308 | GenBank | EDL08269.1 | 175 | lipocalin 8 [Mus musculus] |
| GI:14994308 | GenBank | AHD66057.1 | 175 | Sequence 6 from patent US 8580941 |
| GI:14994308 | SwissProt | Q924P3.1 | 175 | RecName: Full=Epididymal-specific lipocalin-8; AltName: Full=Epididymal 17 kDa lipocalin; Short=EP17; Short=mEP17; Flags: Precursor [Mus musculus] |
Related Sequences to LMP003532 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14994308 | GenBank | ABG24234.1 | 175 | lipocalin 8 [Rattus norvegicus] |
| GI:14994308 | GenBank | EDL93551.1 | 175 | lipocalin 8 (predicted) [Rattus norvegicus] |
| GI:14994308 | RefSeq | NP_001121655.1 | 175 | epididymal-specific lipocalin-8 precursor [Rattus norvegicus] |
| GI:14994308 | RefSeq | XP_005083823.1 | 193 | PREDICTED: epididymal-specific lipocalin-8 [Mesocricetus auratus] |
| GI:14994308 | RefSeq | XP_006981171.1 | 175 | PREDICTED: epididymal-specific lipocalin-8 [Peromyscus maniculatus bairdii] |
| GI:14994308 | RefSeq | XP_006233694.2 | 230 | PREDICTED: epididymal-specific lipocalin-8 isoform X1 [Rattus norvegicus] |