Gene/Proteome Database (LMPD)
LMPD ID
LMP003572
Gene ID
Species
Mus musculus (Mouse)
Gene Name
zinc finger, DHHC domain containing 9
Gene Symbol
Synonyms
6430508G22; 9530098M12Rik
Alternate Names
palmitoyltransferase ZDHHC9; DHHC9; DHHC-9; zinc finger DHHC domain-containing protein 9
Chromosome
X
Map Location
X A4|X
EC Number
2.3.1.225
Proteins
| palmitoyltransferase ZDHHC9 | |
|---|---|
| Refseq ID | NP_766053 |
| Protein GI | 27369636 |
| UniProt ID | P59268 |
| mRNA ID | NM_172465 |
| Length | 364 |
| RefSeq Status | VALIDATED |
| MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPASTEHMNSNEMAEDTSIPEEMPPPEPPEPPQEASEAEK | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC domain containing 9
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISS:UniProt | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031228 | ISS:UniProt | C | intrinsic component of Golgi membrane |
| GO:0002178 | ISS:UniProt | C | palmitoyltransferase complex |
| GO:0043849 | ISS:UniProt | F | Ras palmitoyltransferase activity |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018230 | ISS:UniProt | P | peptidyl-L-cysteine S-palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC domain containing 9
Protein Entry
ZDHC9_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
| Function | The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. {ECO:0000250}. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily. {ECO:0000305}. |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Subunit | Interacts with GOLGA7. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003572 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 27369636 | RefSeq | NP_766053 | 364 | palmitoyltransferase ZDHHC9 |
Identical Sequences to LMP003572 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27369636 | DBBJ | BAC27774.1 | 364 | unnamed protein product [Mus musculus] |
| GI:27369636 | GenBank | AAH42618.1 | 364 | Zdhhc9 protein [Mus musculus] |
| GI:27369636 | GenBank | AAH90832.1 | 364 | Zdhhc9 protein [Mus musculus] |
| GI:27369636 | GenBank | EDL29071.1 | 364 | zinc finger, DHHC domain containing 9, isoform CRA_d [Mus musculus] |
| GI:27369636 | RefSeq | XP_006541517.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 isoform X1 [Mus musculus] |
| GI:27369636 | SwissProt | P59268.1 | 364 | RecName: Full=Palmitoyltransferase ZDHHC9; AltName: Full=Zinc finger DHHC domain-containing protein 9; Short=DHHC-9; Short=DHHC9 [Mus musculus] |
Related Sequences to LMP003572 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27369636 | RefSeq | XP_003499027.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Cricetulus griseus] |
| GI:27369636 | RefSeq | XP_007634453.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Cricetulus griseus] |
| GI:27369636 | RefSeq | XP_007634460.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Cricetulus griseus] |
| GI:27369636 | RefSeq | XP_007624606.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Cricetulus griseus] |
| GI:27369636 | RefSeq | XP_007624607.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Cricetulus griseus] |
| GI:27369636 | RefSeq | XP_008824934.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Nannospalax galili] |