Gene/Proteome Database (LMPD)
LMPD ID
LMP003601
Gene ID
Species
Homo sapiens (Human)
Gene Name
myo-inositol oxygenase
Gene Symbol
Synonyms
ALDRL6
Alternate Names
inositol oxygenase; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6
Chromosome
22
Map Location
22q13.3
EC Number
1.13.99.1
Proteins
| inositol oxygenase | |
|---|---|
| Refseq ID | NP_060054 |
| Protein GI | 33667030 |
| UniProt ID | Q9UGB7 |
| mRNA ID | NM_017584 |
| Length | 285 |
| RefSeq Status | VALIDATED |
| MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | ISS:UniProtKB | C | cytoplasm |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0016234 | ISS:UniProtKB | C | inclusion body |
| GO:0050661 | IEA:Ensembl | F | NADP binding |
| GO:0004033 | ISS:UniProtKB | F | aldo-keto reductase (NADP) activity |
| GO:0008199 | IDA:UniProtKB | F | ferric iron binding |
| GO:0050113 | IDA:UniProtKB | F | inositol oxygenase activity |
| GO:0016651 | IEA:Ensembl | F | oxidoreductase activity, acting on NAD(P)H |
| GO:0016701 | ISS:UniProtKB | F | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen |
| GO:0019310 | IDA:UniProtKB | P | inositol catabolic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007828 | Inositol_oxygenase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UGB7-1; Sequence=Displayed; Name=2; IsoId=Q9UGB7-2; Sequence=VSP_041667, VSP_041668; |
| Catalytic Activity | Myo-inositol + O(2) = D-glucuronate + H(2)O. |
| Cofactor | Name=Fe cation; Xref=ChEBI |
| Pathway | Polyol metabolism; myo-inositol degradation into D- glucuronate; D-glucuronate from myo-inositol: step 1/1. |
| Similarity | Belongs to the myo-inositol oxygenase family. |
| Subcellular Location | Cytoplasm . |
| Tissue Specificity | Kidney specific. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003601 (as displayed in Record Overview)
Identical Sequences to LMP003601 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:33667030 | DBBJ | BAI46345.1 | 285 | myo-inositol oxygenase, partial [synthetic construct] |
| GI:33667030 | EMBL | CAK54459.1 | 285 | MIOX [synthetic construct] |
| GI:33667030 | EMBL | CAK54758.1 | 285 | MIOX, partial [synthetic construct] |
| GI:33667030 | GenBank | EAW73544.1 | 285 | myo-inositol oxygenase, isoform CRA_a [Homo sapiens] |
| GI:33667030 | GenBank | AHD73153.1 | 285 | Sequence 10221 from patent US 8586006 |
| GI:33667030 | GenBank | AIC51794.1 | 285 | MIOX, partial [synthetic construct] |
Related Sequences to LMP003601 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:33667030 | EMBL | CAH89668.1 | 285 | hypothetical protein [Pongo abelii] |
| GI:33667030 | GenBank | AAF25204.1 | 285 | unknown [Homo sapiens] |
| GI:33667030 | RefSeq | NP_001124754.1 | 285 | inositol oxygenase [Pongo abelii] |
| GI:33667030 | RefSeq | XP_003281515.1 | 285 | PREDICTED: inositol oxygenase [Nomascus leucogenys] |
| GI:33667030 | RefSeq | XP_003811069.1 | 285 | PREDICTED: inositol oxygenase isoform X1 [Pan paniscus] |
| GI:33667030 | SwissProt | Q5REY9.1 | 285 | RecName: Full=Inositol oxygenase; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase [Pongo abelii] |