Gene/Proteome Database (LMPD)

LMPD ID
LMP003630
Gene ID
10011
Species
Homo sapiens (Human)
Gene Name
steroid receptor RNA activator 1
Gene Symbol
SRA1
Synonyms
SRA; SRAP; STRAA1; pp7684
Chromosome
5
Map Location
5q31.3
Summary
Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. [provided by RefSeq, Mar 2012]
Orthologs
View orthologs and multiple alignments for SRA1

Proteins

steroid receptor RNA activator 1 isoform 1
Refseq ID NP_001030312
Protein GI 113951734
UniProt ID Q9HD15
mRNA ID NM_001035235
Length 236
RefSeq Status REVIEWED
MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
steroid receptor RNA activator 1 isoform 2
Refseq ID NP_001240693
Protein GI 113951734
UniProt ID Q9HD15
mRNA ID NM_001253764
Length 236
RefSeq Status REVIEWED
MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS

Gene Information

Entrez Gene ID
10011
Gene Name
steroid receptor RNA activator 1
Gene Symbol
SRA1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031252 IEA:Ensembl C cell leading edge
GO:0005737 IDA:HPA C cytoplasm
GO:0045171 IDA:HPA C intercellular bridge
GO:0015630 IDA:HPA C microtubule cytoskeleton
GO:0005634 IDA:UniProtKB C nucleus
GO:0005886 IDA:HPA C plasma membrane
GO:0030529 IPI:UniProtKB C ribonucleoprotein complex
GO:0005667 IEA:Ensembl C transcription factor complex
GO:0003677 IEA:Ensembl F DNA binding
GO:0030374 IBA:RefGenome F ligand-dependent nuclear receptor transcription coactivator activity
GO:0010861 IEA:Ensembl F thyroid hormone receptor activator activity
GO:0003713 IDA:UniProtKB F transcription coactivator activity
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0030154 IDA:UniProtKB P cell differentiation
GO:0008283 IDA:UniProtKB P cell proliferation
GO:2000273 IBA:RefGenome P positive regulation of receptor activity
GO:0045944 IEA:Ensembl P positive regulation of transcription from RNA polymerase II promoter
GO:0042981 IDA:UniProtKB P regulation of apoptotic process
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

Domain Information

InterPro Annotations

Accession Description
IPR009917 Steroid receptor RNA activator-protein/coat protein complex II, Sec31

UniProt Annotations

Entry Information

Gene Name
steroid receptor RNA activator 1
Protein Entry
NONE_CAEEL
UniProt ID
Q9HD15
Species
Human

Comments

Comment Type Description
Function Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand- dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis. {ECO
Interaction Q92769:HDAC2; NbExp=2; IntAct=EBI-727136, EBI-301821;
Miscellaneous Appears to be the first example of a new class of functional RNAs also able to encode a protein.
Sequence Caution Sequence=AAH40043.2; Type=Frameshift; Positions=29; Evidence= ;
Similarity Belongs to the SRA1 family.
Subcellular Location Nucleus . Cytoplasm .
Subunit SRA1 RNA exists in a ribonucleoprotein complex containing NCOA1. The RNA also forms a complex with PUS1 and RARG in the nucleus. Interacts with AR. {ECO
Tissue Specificity Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up- regulated in human tumors of the breast, ovary, and uterus. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP003630 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
113951734 RefSeq NP_001030312 236 steroid receptor RNA activator 1 isoform 1
113951734 RefSeq NP_001240693 236 steroid receptor RNA activator 1 isoform 2

Identical Sequences to LMP003630 proteins

Reference Database Accession Length Protein Name
GI:113951734 DBBJ BAJ20657.1 236 steroid receptor RNA activator 1, partial [synthetic construct]
GI:113951734 DBBJ BAJ20657.1 236 steroid receptor RNA activator 1, partial [synthetic construct]
GI:113951734 GenBank AAG02114.1 236 steroid receptor RNA activator isoform 1 [Homo sapiens]
GI:113951734 GenBank AAG02114.1 236 steroid receptor RNA activator isoform 1 [Homo sapiens]
GI:113951734 GenBank AAI52789.1 236 Steroid receptor RNA activator 1, partial [synthetic construct]
GI:113951734 GenBank AAI52789.1 236 Steroid receptor RNA activator 1, partial [synthetic construct]
GI:113951734 GenBank AAI56761.1 236 Steroid receptor RNA activator 1 [synthetic construct]
GI:113951734 GenBank AAI56761.1 236 Steroid receptor RNA activator 1 [synthetic construct]
GI:113951734 GenBank AED82378.1 236 Sequence 1115 from patent US 7919467
GI:113951734 GenBank AED82378.1 236 Sequence 1115 from patent US 7919467
GI:113951734 SwissProt Q9HD15.1 236 RecName: Full=Steroid receptor RNA activator 1; AltName: Full=Steroid receptor RNA activator protein; Short=SRAP [Homo sapiens]
GI:113951734 SwissProt Q9HD15.1 236 RecName: Full=Steroid receptor RNA activator 1; AltName: Full=Steroid receptor RNA activator protein; Short=SRAP [Homo sapiens]

Related Sequences to LMP003630 proteins

Reference Database Accession Length Protein Name
GI:113951734 GenBank JAA00586.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA00586.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA13099.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA13099.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA22388.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA22388.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA35253.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 GenBank JAA35253.1 236 steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 RefSeq XP_001137717.2 236 PREDICTED: steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 RefSeq XP_001137717.2 236 PREDICTED: steroid receptor RNA activator 1 [Pan troglodytes]
GI:113951734 RefSeq XP_004042682.1 236 PREDICTED: steroid receptor RNA activator 1 [Gorilla gorilla gorilla]
GI:113951734 RefSeq XP_004042682.1 236 PREDICTED: steroid receptor RNA activator 1 [Gorilla gorilla gorilla]