Gene/Proteome Database (LMPD)

LMPD ID
LMP003790
Gene ID
8818
Species
Homo sapiens (Human)
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
DPM2
Synonyms
CDG1U
Alternate Names
dolichol phosphate-mannose biosynthesis regulatory protein; DPM synthase subunit 2; DPM synthase complex subunit; dolichol-phosphate mannose synthase subunit 2
Chromosome
9
Map Location
9q34.13
Summary
Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a hydrophobic protein that contains 2 predicted transmembrane domains and a putative ER localization signal near the C terminus. This protein associates with DPM1 in vivo and is required for the ER localization and stable expression of DPM1 and also enhances the binding of dolichol-phosphate to DPM1. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for DPM2

Proteins

dolichol phosphate-mannose biosynthesis regulatory protein
Refseq ID NP_003854
Protein GI 4503365
UniProt ID O94777
mRNA ID NM_003863
Length 84
RefSeq Status REVIEWED
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ

Gene Information

Entrez Gene ID
8818
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
DPM2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0033185 IDA:UniProtKB C dolichol-phosphate-mannose synthase complex
GO:0005789 TAS:HGNC C endoplasmic reticulum membrane
GO:0000506 TAS:HGNC C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0030176 IEA:InterPro C integral component of endoplasmic reticulum membrane
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0004582 IEA:Ensembl F dolichyl-phosphate beta-D-mannosyltransferase activity
GO:0030234 IEA:Ensembl F enzyme regulator activity
GO:0006501 TAS:Reactome P C-terminal protein lipidation
GO:0006506 IDA:UniProtKB P GPI anchor biosynthetic process
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0019348 IEA:Ensembl P dolichol metabolic process
GO:0006488 TAS:Reactome P dolichol-linked oligosaccharide biosynthetic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0016254 TAS:Reactome P preassembly of GPI anchor in ER membrane
GO:0018279 TAS:Reactome P protein N-linked glycosylation via asparagine
GO:0035269 TAS:HGNC P protein O-linked mannosylation
GO:0031647 IPI:UniProtKB P regulation of protein stability

KEGG Pathway Links

KEGG Pathway ID Description
hsa00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
hsa00510 N-Glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_2032 Synthesis of dolichyl-phosphate mannose
REACT_952 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR009914 Dolichol phosphate-mannose biosynthesis regulatory

UniProt Annotations

Entry Information

Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Protein Entry
DPM2_HUMAN
UniProt ID
O94777
Species
Human

Comments

Comment Type Description
Disease Congenital disorder of glycosylation 1U (CDG1U) [MIM
Function Regulates the biosynthesis of dolichol phosphate- mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. When associated with the GPI-GlcNAc transferase (GPI-GnT) complex enhances but is not essential for its activity.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DPM2 family.
Subcellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein.
Subunit Component of the dolichol-phosphate mannose (DPM) synthase complex composed of DPM1, DPM2 and DPM3; in the complex interacts directly with DPM3. Associates with the GPI-GlcNAc transferase (GPI-GnT) complex.
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=DPM2";

Identical and Related Proteins

Unique RefSeq proteins for LMP003790 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4503365 RefSeq NP_003854 84 dolichol phosphate-mannose biosynthesis regulatory protein

Identical Sequences to LMP003790 proteins

Reference Database Accession Length Protein Name
GI:4503365 EMBL CAG46931.1 84 DPM2, partial [Homo sapiens]
GI:4503365 GenBank AAG43140.1 84 My026 protein [Homo sapiens]
GI:4503365 GenBank AEH67658.1 84 Sequence 43 from patent US 7928215
GI:4503365 GenBank AFQ84267.1 84 Sequence 43 from patent US 8252294
GI:4503365 GenBank AHD77838.1 84 Sequence 24465 from patent US 8586006
GI:4503365 SwissProt O94777.3 84 RecName: Full=Dolichol phosphate-mannose biosynthesis regulatory protein; AltName: Full=Dolichol-phosphate mannose synthase subunit 2; Short=DPM synthase subunit 2 [Homo sapiens]

Related Sequences to LMP003790 proteins

Reference Database Accession Length Protein Name
GI:4503365 DBBJ BAG70287.1 84 dolichol phosphate-mannose biosynthesis regulatory protein, partial [Homo sapiens]
GI:4503365 GenBank AAX36999.1 85 dolichyl-phosphate mannosyltransferase polypeptide 2 regulatory subunit, partial [synthetic construct]
GI:4503365 GenBank AFO18215.1 84 Sequence 29 from patent US 8206947
GI:4503365 GenBank JAA03561.1 84 dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit [Pan troglodytes]
GI:4503365 GenBank JAA11511.1 84 dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit [Pan troglodytes]
GI:4503365 RefSeq XP_003822356.1 84 PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Pan paniscus]