Gene/Proteome Database (LMPD)
Proteins
aldo-keto reductase family 1, member C20 | |
---|---|
Refseq ID | NP_473421 |
Protein GI | 16905111 |
UniProt ID | Q9CZU0 |
mRNA ID | NM_054080 |
Length | 262 |
RefSeq Status | PROVISIONAL |
MNSKQQTVLLNDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGLAIRSKIVDGTVKREDIFCTSKVWQTFHRPELVQPGENYFPKDENGKFIYDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVECHPYLNQRKLLDFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQVQRGVVVLAKSFIEKRIKENMQVMSCFGY |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C20
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0004033 | ISA:MGI | F | aldo-keto reductase (NADP) activity |
GO:0006694 | ISA:MGI | P | steroid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member C20
Protein Entry
Q9CZU0_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP003932 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16905111 | RefSeq | NP_473421 | 262 | aldo-keto reductase family 1, member C20 |
Identical Sequences to LMP003932 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16905111 | DBBJ | BAB28069.1 | 262 | unnamed protein product [Mus musculus] |
GI:16905111 | GenBank | EDL32251.1 | 262 | mCG9092, isoform CRA_b [Mus musculus] |
Related Sequences to LMP003932 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16905111 | DBBJ | BAE94926.1 | 323 | aldo-keto reductase [Mus musculus] |
GI:16905111 | GenBank | AAH21607.1 | 323 | Akr1c20 protein [Mus musculus] |
GI:16905111 | GenBank | EDL32252.1 | 323 | mCG9092, isoform CRA_c [Mus musculus] |
GI:16905111 | GenBank | ACQ18785.1 | 323 | Sequence 43 from patent US 7510851 |
GI:16905111 | RefSeq | XP_006516527.1 | 323 | PREDICTED: aldo-keto reductase family 1, member C20 isoform X1 [Mus musculus] |
GI:16905111 | RefSeq | XP_006516529.1 | 296 | PREDICTED: aldo-keto reductase family 1, member C20 isoform X3 [Mus musculus] |