Gene/Proteome Database (LMPD)
LMPD ID
LMP004109
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 11
Gene Symbol
Synonyms
Dhrs8; Pan1b; SDR2; retSDR2
Alternate Names
estradiol 17-beta-dehydrogenase 11; 17bHSD11; 17betaHSD11; 17betaHSDXI; 17beta-HSD11; 17-beta-HSD 11; 17-beta-HSD XI; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase XI; dehydrogenase/reductase SDR family member 8; dehydrogenase/reductase (SDR family) member 8; retinal short-chain dehydrogenase/reductase 2; retinal short-chain dehydrogenase/reductase SDR2
Chromosome
5
Map Location
5|5 E4
EC Number
1.1.1.62
Proteins
| estradiol 17-beta-dehydrogenase 11 precursor | |
|---|---|
| Refseq ID | NP_444492 |
| Protein GI | 16716597 |
| UniProt ID | Q9EQ06 |
| mRNA ID | NM_053262 |
| Length | 298 |
| RefSeq Status | PROVISIONAL |
| MKYLLDLILLLPLLIVFSIESLVKLFIPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDINKNGIEETAAKCRKLGAQAHPFVVDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAALGRTGVRTSCLCPNFINTGFIKNPSTNLGPTLEPEEVVEHLMHGILTEKQMIFVPSSIALLTVLERIVPERFLQVLKHRINVKFDAVVGYKDK | |
| sig_peptide: 1..21 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (Q9EQ06.1) calculated_mol_wt: 2447 peptide sequence: MKYLLDLILLLPLLIVFSIES mat_peptide: 22..298 product: Estradiol 17-beta-dehydrogenase 11 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9EQ06.1) calculated_mol_wt: 30452 peptide sequence: LVKLFIPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDINKNGIEETAAKCRKLGAQAHPFVVDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAALGRTGVRTSCLCPNFINTGFIKNPSTNLGPTLEPEEVVEHLMHGILTEKQMIFVPSSIALLTVLERIVPERFLQVLKHRINVKFDAVVGYKDK | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 11
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005811 | IEA:Ensembl | C | lipid particle |
| GO:0004303 | IEA:UniProtKB-EC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0006710 | IEA:Ensembl | P | androgen catabolic process |
| GO:0006694 | IEA:UniProtKB-KW | P | steroid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-2 | biosynthesis of estrogens |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 11
Protein Entry
DHB11_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9EQ06-1; Sequence=Displayed; Name=2; IsoId=Q9EQ06-2; Sequence=VSP_015013, VSP_015014; Note=No experimental confirmation available.; |
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. {ECO:0000269|PubMed:11165019}. |
| Function | Can convert androstan-3-alpha,17-beta-diol (3-alpha- diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. Cytoplasm. Note=According to PubMed:12697717 it is cytoplasmic. However, the relevance of such result remains unclear. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004109 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16716597 | RefSeq | NP_444492 | 298 | estradiol 17-beta-dehydrogenase 11 precursor |
Identical Sequences to LMP004109 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16716597 | DBBJ | BAE32840.1 | 298 | unnamed protein product [Mus musculus] |
| GI:16716597 | DBBJ | BAE33094.1 | 298 | unnamed protein product [Mus musculus] |
| GI:16716597 | DBBJ | BAE33115.1 | 298 | unnamed protein product [Mus musculus] |
| GI:16716597 | DBBJ | BAE33194.1 | 298 | unnamed protein product [Mus musculus] |
| GI:16716597 | DBBJ | BAE42129.1 | 298 | unnamed protein product [Mus musculus] |
| GI:16716597 | GenBank | EDL20235.1 | 298 | dehydrogenase/reductase (SDR family) member 8, isoform CRA_b [Mus musculus] |
Related Sequences to LMP004109 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16716597 | GenBank | AAH78929.1 | 298 | Hydroxysteroid (17-beta) dehydrogenase 11 [Rattus norvegicus] |
| GI:16716597 | RefSeq | NP_001004209.1 | 298 | estradiol 17-beta-dehydrogenase 11 precursor [Rattus norvegicus] |
| GI:16716597 | RefSeq | XP_006250689.1 | 298 | PREDICTED: estradiol 17-beta-dehydrogenase 11 isoform X1 [Rattus norvegicus] |
| GI:16716597 | RefSeq | XP_006250691.1 | 298 | PREDICTED: estradiol 17-beta-dehydrogenase 11 isoform X1 [Rattus norvegicus] |
| GI:16716597 | RefSeq | XP_006975486.1 | 298 | PREDICTED: estradiol 17-beta-dehydrogenase 11 [Peromyscus maniculatus bairdii] |
| GI:16716597 | SwissProt | Q6AYS8.1 | 298 | RecName: Full=Estradiol 17-beta-dehydrogenase 11; AltName: Full=17-beta-hydroxysteroid dehydrogenase 11; Short=17-beta-HSD 11; Short=17bHSD11; Short=17betaHSD11; AltName: Full=17-beta-hydroxysteroid dehydrogenase XI; Short=17-beta-HSD XI; Short=17betaHSDXI; AltName: Full=Dehydrogenase/reductase SDR family member 8; Flags: Precursor [Rattus norvegicus] |