Gene/Proteome Database (LMPD)
LMPD ID
LMP004118
Gene ID
Species
Homo sapiens (Human)
Gene Name
zinc finger, DHHC-type containing 7
Gene Symbol
Synonyms
DHHC7; SERZ-B; SERZ1; ZNF370
Alternate Names
palmitoyltransferase ZDHHC7; DHHC-7; zinc finger protein 370; zinc finger, DHHC domain containing 7; zinc finger DHHC domain-containing protein 7; Sertoli cell gene with zinc finger domain-β
Chromosome
16
Map Location
16q24.1
EC Number
2.3.1.225
Proteins
palmitoyltransferase ZDHHC7 isoform 1 | |
---|---|
Refseq ID | NP_001139020 |
Protein GI | 224493964 |
UniProt ID | Q9NXF8 |
mRNA ID | NM_001145548 |
Length | 345 |
RefSeq Status | VALIDATED |
MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPEKSSDCRPSACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV |
palmitoyltransferase ZDHHC7 isoform 2 | |
---|---|
Refseq ID | NP_060210 |
Protein GI | 224493956 |
UniProt ID | Q9NXF8 |
mRNA ID | NM_017740 |
Length | 308 |
RefSeq Status | VALIDATED |
MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKDFWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 7
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IDA:UniProtKB | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016409 | IDA:UniProt | F | palmitoyltransferase activity |
GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0018230 | IMP:UniProtKB | P | peptidyl-L-cysteine S-palmitoylation |
GO:0018345 | IDA:UniProt | P | protein palmitoylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 7
Protein Entry
ZDHC7_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NXF8-1; Sequence=Displayed; Name=2; IsoId=Q9NXF8-2; Sequence=VSP_006942; |
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Function | Palmitoyltransferase with broad specificity. Palmitoylates SNAP25 and DLG4/PSD95. May palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and thereby regulate their synaptic clustering and/or cell surface stability (By similarity). Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptors. |
Sequence Caution | Sequence=AAH17702.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAA91814.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; |
Similarity | Belongs to the DHHC palmitoyltransferase family. |
Similarity | Contains 1 DHHC-type zinc finger. |
Subcellular Location | Membrane ; Multi-pass membrane protein . Golgi apparatus . |
Identical and Related Proteins
Unique RefSeq proteins for LMP004118 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
224493964 | RefSeq | NP_001139020 | 345 | palmitoyltransferase ZDHHC7 isoform 1 |
224493956 | RefSeq | NP_060210 | 308 | palmitoyltransferase ZDHHC7 isoform 2 |
Identical Sequences to LMP004118 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:224493964 | GenBank | AAH18772.1 | 345 | ZDHHC7 protein [Homo sapiens] |
GI:224493964 | GenBank | EAW95463.1 | 345 | zinc finger, DHHC-type containing 7, isoform CRA_a [Homo sapiens] |
GI:224493964 | GenBank | ABM82894.1 | 345 | zinc finger, DHHC-type containing 7 [synthetic construct] |
GI:224493964 | GenBank | ABM86083.1 | 345 | zinc finger, DHHC-type containing 7, partial [synthetic construct] |
GI:224493956 | GenBank | JAA40108.1 | 308 | zinc finger, DHHC-type containing 7 [Pan troglodytes] |
GI:224493964 | GenBank | AIC56711.1 | 345 | ZDHHC7, partial [synthetic construct] |
GI:224493956 | RefSeq | XP_005592742.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 [Macaca fascicularis] |
GI:224493956 | RefSeq | XP_007992434.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 [Chlorocebus sabaeus] |
GI:224493956 | RefSeq | XP_008972587.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 [Pan paniscus] |
GI:224493956 | RefSeq | XP_008972588.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 [Pan paniscus] |
GI:224493956 | RefSeq | XP_009429616.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 isoform X2 [Pan troglodytes] |
Related Sequences to LMP004118 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:224493956 | DBBJ | BAA91055.1 | 308 | unnamed protein product [Homo sapiens] |
GI:224493964 | GenBank | JAA07271.1 | 345 | zinc finger, DHHC-type containing 7 [Pan troglodytes] |
GI:224493964 | GenBank | JAA21668.1 | 345 | zinc finger, DHHC-type containing 7 [Pan troglodytes] |
GI:224493964 | GenBank | JAA27610.1 | 345 | zinc finger, DHHC-type containing 7 [Pan troglodytes] |
GI:224493964 | GenBank | JAA40109.1 | 345 | zinc finger, DHHC-type containing 7 [Pan troglodytes] |
GI:224493956 | GenBank | AGJ46259.1 | 308 | Sequence 20 from patent US 8404655 |
GI:224493956 | GenBank | AHD75409.1 | 308 | Sequence 16688 from patent US 8586006 |
GI:224493956 | RefSeq | XP_003272546.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 isoform 1 [Nomascus leucogenys] |
GI:224493956 | RefSeq | XP_003922862.1 | 309 | PREDICTED: palmitoyltransferase ZDHHC7 isoform X2 [Saimiri boliviensis boliviensis] |
GI:224493964 | RefSeq | XP_009429614.1 | 345 | PREDICTED: palmitoyltransferase ZDHHC7 isoform X1 [Pan troglodytes] |
GI:224493964 | RefSeq | XP_009429615.1 | 345 | PREDICTED: palmitoyltransferase ZDHHC7 isoform X1 [Pan troglodytes] |
GI:224493956 | RefSeq | XP_010353924.1 | 308 | PREDICTED: palmitoyltransferase ZDHHC7 [Rhinopithecus roxellana] |