Gene/Proteome Database (LMPD)
Proteins
| progestin and adipoQ receptor family member 4 isoform 1 | |
|---|---|
| Refseq ID | NP_689554 |
| Protein GI | 31542756 |
| UniProt ID | Q8N4S7 |
| mRNA ID | NM_152341 |
| Length | 273 |
| RefSeq Status | VALIDATED |
| MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD | |
| progestin and adipoQ receptor family member 4 isoform 2 | |
|---|---|
| Refseq ID | NP_001271440 |
| Protein GI | 548961384 |
| UniProt ID | Q8N4S7 |
| mRNA ID | NM_001284511 |
| Length | 234 |
| RefSeq Status | VALIDATED |
| MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD | |
| progestin and adipoQ receptor family member 4 isoform 3 | |
|---|---|
| Refseq ID | NP_001271441 |
| Protein GI | 548961384 |
| UniProt ID | Q8N4S7 |
| mRNA ID | NM_001284512 |
| Length | 234 |
| RefSeq Status | VALIDATED |
| MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD | |
| progestin and adipoQ receptor family member 4 isoform 4 | |
|---|---|
| Refseq ID | NP_001271442 |
| Protein GI | 548961384 |
| UniProt ID | I3L1A2 |
| mRNA ID | NM_001284513 |
| Length | 234 |
| RefSeq Status | VALIDATED |
| MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD | |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member IV
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004872 | IBA:RefGenome | F | receptor activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member IV
Protein Entry
PAQR4_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N4S7-1; Sequence=Displayed; Name=2; IsoId=Q8N4S7-2; Sequence=VSP_011481; Name=3; IsoId=Q8N4S7-3; Sequence=VSP_011482; Note=No experimental confirmation available.; |
| Similarity | Belongs to the ADIPOR family. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Relatively widely expressed in a range of tissues. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004122 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 31542756 | RefSeq | NP_689554 | 273 | progestin and adipoQ receptor family member 4 isoform 1 |
| 548961384 | RefSeq | NP_001271440 | 234 | progestin and adipoQ receptor family member 4 isoform 2 |
| 548961384 | RefSeq | NP_001271441 | 234 | progestin and adipoQ receptor family member 4 isoform 3 |
| 548961384 | RefSeq | NP_001271442 | 234 | progestin and adipoQ receptor family member 4 isoform 4 |
Identical Sequences to LMP004122 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:548961384 | GenBank | EAW85442.1 | 234 | progestin and adipoQ receptor family member IV, isoform CRA_b [Homo sapiens] |
| GI:548961384 | GenBank | EAW85442.1 | 234 | progestin and adipoQ receptor family member IV, isoform CRA_b [Homo sapiens] |
| GI:548961384 | GenBank | EAW85442.1 | 234 | progestin and adipoQ receptor family member IV, isoform CRA_b [Homo sapiens] |
| GI:548961384 | GenBank | EAW85444.1 | 234 | progestin and adipoQ receptor family member IV, isoform CRA_b [Homo sapiens] |
| GI:548961384 | GenBank | EAW85444.1 | 234 | progestin and adipoQ receptor family member IV, isoform CRA_b [Homo sapiens] |
| GI:548961384 | GenBank | EAW85444.1 | 234 | progestin and adipoQ receptor family member IV, isoform CRA_b [Homo sapiens] |
| GI:31542756 | GenBank | JAA17577.1 | 273 | progestin and adipoQ receptor family member IV [Pan troglodytes] |
| GI:31542756 | GenBank | JAA27349.1 | 273 | progestin and adipoQ receptor family member IV [Pan troglodytes] |
| GI:31542756 | GenBank | JAA27350.1 | 273 | progestin and adipoQ receptor family member IV [Pan troglodytes] |
| GI:31542756 | GenBank | JAA39767.1 | 273 | progestin and adipoQ receptor family member IV [Pan troglodytes] |
| GI:31542756 | GenBank | JAA39768.1 | 273 | progestin and adipoQ receptor family member IV [Pan troglodytes] |
| GI:31542756 | RefSeq | XP_004057093.1 | 273 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 1 [Gorilla gorilla gorilla] |
| GI:548961384 | RefSeq | XP_004057094.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 2 [Gorilla gorilla gorilla] |
| GI:548961384 | RefSeq | XP_004057094.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 2 [Gorilla gorilla gorilla] |
| GI:548961384 | RefSeq | XP_004057094.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 2 [Gorilla gorilla gorilla] |
Related Sequences to LMP004122 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:548961384 | DBBJ | BAB70758.1 | 234 | unnamed protein product [Homo sapiens] |
| GI:548961384 | DBBJ | BAB70758.1 | 234 | unnamed protein product [Homo sapiens] |
| GI:548961384 | DBBJ | BAB70758.1 | 234 | unnamed protein product [Homo sapiens] |
| GI:548961384 | GenBank | ABE14075.1 | 234 | Sequence 1641 from patent US 6979557 |
| GI:548961384 | GenBank | ABE14075.1 | 234 | Sequence 1641 from patent US 6979557 |
| GI:548961384 | GenBank | ABE14075.1 | 234 | Sequence 1641 from patent US 6979557 |
| GI:548961384 | GenBank | EAW85441.1 | 273 | progestin and adipoQ receptor family member IV, isoform CRA_a [Homo sapiens] |
| GI:548961384 | GenBank | EAW85441.1 | 273 | progestin and adipoQ receptor family member IV, isoform CRA_a [Homo sapiens] |
| GI:548961384 | GenBank | EAW85441.1 | 273 | progestin and adipoQ receptor family member IV, isoform CRA_a [Homo sapiens] |
| GI:548961384 | GenBank | EAW85443.1 | 273 | progestin and adipoQ receptor family member IV, isoform CRA_a [Homo sapiens] |
| GI:548961384 | GenBank | EAW85443.1 | 273 | progestin and adipoQ receptor family member IV, isoform CRA_a [Homo sapiens] |
| GI:548961384 | GenBank | EAW85443.1 | 273 | progestin and adipoQ receptor family member IV, isoform CRA_a [Homo sapiens] |
| GI:31542756 | GenBank | AFE64559.1 | 273 | progestin and adipoQ receptor family member 4 [Macaca mulatta] |
| GI:31542756 | GenBank | AFH29878.1 | 273 | progestin and adipoQ receptor family member 4 [Macaca mulatta] |
| GI:31542756 | GenBank | AFH29879.1 | 273 | progestin and adipoQ receptor family member 4 [Macaca mulatta] |
| GI:548961384 | RefSeq | XP_003269237.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 2 [Nomascus leucogenys] |
| GI:548961384 | RefSeq | XP_003269237.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 2 [Nomascus leucogenys] |
| GI:548961384 | RefSeq | XP_003269237.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform 2 [Nomascus leucogenys] |
| GI:31542756 | RefSeq | NP_001247838.1 | 273 | progestin and adipoQ receptor family member 4 [Macaca mulatta] |
| GI:31542756 | RefSeq | XP_005591076.1 | 273 | PREDICTED: progestin and adipoQ receptor family member 4 isoform X1 [Macaca fascicularis] |
| GI:31542756 | RefSeq | XP_005591077.1 | 273 | PREDICTED: progestin and adipoQ receptor family member 4 isoform X2 [Macaca fascicularis] |
| GI:548961384 | RefSeq | XP_006743096.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform X2 [Leptonychotes weddellii] |
| GI:548961384 | RefSeq | XP_006743096.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform X2 [Leptonychotes weddellii] |
| GI:548961384 | RefSeq | XP_006743096.1 | 234 | PREDICTED: progestin and adipoQ receptor family member 4 isoform X2 [Leptonychotes weddellii] |