Gene/Proteome Database (LMPD)
LMPD ID
LMP004196
Gene ID
Species
Mus musculus (Mouse)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta)
Gene Symbol
Synonyms
AU041707; AW545732; GPAT4; Tsarg7
Alternate Names
glycerol-3-phosphate acyltransferase 6; 1-AGPAT 6; LPAAT-zeta; 1-AGP acyltransferase 6; glycerol-3-phosphate acyltransferase 4; lysophosphatidic acid acyltransferase zeta; putative lysophosphatidic acid acyltransferase; acyl-CoA:glycerol-3-phosphate acyltransferase 4; testis spermatogenesis apoptosis-related protein 7
Chromosome
8
Map Location
8 A2|8
EC Number
2.3.1.15
Proteins
glycerol-3-phosphate acyltransferase 6 precursor | |
---|---|
Refseq ID | NP_061213 |
Protein GI | 30520301 |
UniProt ID | Q8K2C8 |
mRNA ID | NM_018743 |
Length | 456 |
RefSeq Status | VALIDATED |
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKTLLKIFAWATLRMERGAKERNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDKTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRIALAFTGIGLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREKDEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS | |
sig_peptide: 1..37 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (Q8K2C8.1) calculated_mol_wt: 4077 peptide sequence: MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFG |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
GO:0030176 | NAS:UniProtKB | C | integral component of endoplasmic reticulum membrane |
GO:0004366 | IMP:UniProtKB | F | glycerol-3-phosphate O-acyltransferase activity |
GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
GO:0006637 | IEA:Ensembl | P | acyl-CoA metabolic process |
GO:0046339 | IMP:MGI | P | diacylglycerol metabolic process |
GO:0006631 | IMP:MGI | P | fatty acid metabolic process |
GO:0002071 | IMP:MGI | P | glandular epithelial cell maturation |
GO:0007595 | IMP:UniProtKB | P | lactation |
GO:0008610 | IMP:UniProtKB | P | lipid biosynthetic process |
GO:0030879 | IMP:MGI | P | mammary gland development |
GO:0006656 | IEA:Ensembl | P | phosphatidylcholine biosynthetic process |
GO:0040014 | IMP:MGI | P | regulation of multicellular organism growth |
GO:0019432 | IMP:UniProtKB | P | triglyceride biosynthetic process |
GO:0006641 | IMP:MGI | P | triglyceride metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00561 | Glycerolipid metabolism |
mmu00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5892982 | Synthesis of PA |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta)
Protein Entry
GPAT4_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1- acyl-sn-glycerol 3-phosphate. |
Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}. |
Function | Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis. Active against both saturated and unsaturated long- chain fatty acyl-CoAs (By similarity). {ECO:0000250}. |
Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3. |
Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004196 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30520301 | RefSeq | NP_061213 | 456 | glycerol-3-phosphate acyltransferase 6 precursor |
Identical Sequences to LMP004196 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30520301 | DBBJ | BAE41020.1 | 456 | unnamed protein product [Mus musculus] |
GI:30520301 | DBBJ | BAE36282.1 | 456 | unnamed protein product [Mus musculus] |
GI:30520301 | EMBL | CAT16186.1 | 456 | unnamed protein product [Mus musculus] |
GI:30520301 | GenBank | AAP97283.1 | 456 | putative lysophosphatidic acid acyltransferase [Mus musculus] |
GI:30520301 | GenBank | EDL32868.1 | 456 | 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta), isoform CRA_b [Mus musculus] |
GI:30520301 | SwissProt | Q8K2C8.1 | 456 | RecName: Full=Glycerol-3-phosphate acyltransferase 4; Short=GPAT4; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 6; Short=1-AGP acyltransferase 6; Short=1-AGPAT 6; AltName: Full=Acyl-CoA:glycerol-3-phosphate acyltransferase 4; AltName: Full=Lysophosphatidic acid acyltransferase zeta; Short=LPAAT-zeta; Flags: Precursor [Mus musculus] |
Related Sequences to LMP004196 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30520301 | GenBank | EGV95030.1 | 456 | Glycerol-3-phosphate acyltransferase 4 [Cricetulus griseus] |
GI:30520301 | GenBank | ERE92464.1 | 456 | glycerol-3-phosphate acyltransferase 4 [Cricetulus griseus] |
GI:30520301 | RefSeq | XP_003503367.1 | 456 | PREDICTED: glycerol-3-phosphate acyltransferase 6 [Cricetulus griseus] |
GI:30520301 | RefSeq | XP_006509037.1 | 462 | PREDICTED: glycerol-3-phosphate acyltransferase 6 isoform X1 [Mus musculus] |
GI:30520301 | RefSeq | XP_006983035.1 | 456 | PREDICTED: glycerol-3-phosphate acyltransferase 4 [Peromyscus maniculatus bairdii] |
GI:30520301 | RefSeq | XP_007608062.1 | 456 | PREDICTED: glycerol-3-phosphate acyltransferase 6 [Cricetulus griseus] |