Gene/Proteome Database (LMPD)

LMPD ID
LMP004358
Gene ID
110606
Species
Mus musculus (Mouse)
Gene Name
farnesyltransferase, CAAX box, beta
Gene Symbol
Fntb
Synonyms
2010013E13Rik; AA409500
Alternate Names
protein farnesyltransferase subunit beta; FTase-beta; CAAX farnesyltransferase subunit beta; ras proteins prenyltransferase subunit beta
Chromosome
12
Map Location
12 C3|12 33.73 cM
EC Number
2.5.1.58

Proteins

protein farnesyltransferase subunit beta
Refseq ID NP_666039
Protein GI 22122343
UniProt ID Q8K2I1
mRNA ID NM_145927
Length 437
RefSeq Status PROVISIONAL
MASSSSFTYYCPPSSSPVWSEPLYSLRPEHVRERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLILQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDMVMGVPENVLQPTHPVYNIGPEKVIQATTHFLQKPVPGFEECEDEVTSDPATD

Gene Information

Entrez Gene ID
110606
Gene Name
farnesyltransferase, CAAX box, beta
Gene Symbol
Fntb
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005875 IEA:Ensembl C microtubule associated complex
GO:0005965 ISS:UniProtKB C protein farnesyltransferase complex
GO:0004311 IMP:MGI F farnesyltranstransferase activity
GO:0004660 ISS:UniProtKB F protein farnesyltransferase activity
GO:0008270 ISS:UniProtKB F zinc ion binding
GO:0008285 IMP:MGI P negative regulation of cell proliferation
GO:0045787 IEA:Ensembl P positive regulation of cell cycle
GO:0008284 IMP:MGI P positive regulation of cell proliferation
GO:0048146 IMP:MGI P positive regulation of fibroblast proliferation
GO:0051770 IEA:Ensembl P positive regulation of nitric-oxide synthase biosynthetic process
GO:0018343 ISS:UniProtKB P protein farnesylation
GO:0034097 IEA:Ensembl P response to cytokine
GO:0010035 IEA:Ensembl P response to inorganic substance
GO:0014070 IEA:Ensembl P response to organic cyclic compound
GO:0042060 IMP:MGI P wound healing

KEGG Pathway Links

KEGG Pathway ID Description
ko00900 Terpenoid backbone biosynthesis
mmu00900 Terpenoid backbone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5892893 Inactivation, recovery and regulation of the phototransduction cascade
5892890 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR001330 Prenyltransferase/squalene oxidase
IPR026872 Protein farnesyltransferase subunit beta
IPR008930 Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid

UniProt Annotations

Entry Information

Gene Name
farnesyltransferase, CAAX box, beta
Protein Entry
FNTB_MOUSE
UniProt ID
Q8K2I1
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Farnesyl diphosphate + protein-cysteine = S- farnesyl protein + diphosphate. {ECO:0000269|PubMed:21520375}.
Cofactor Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:21520375}; Note=Binds 1 zinc ion per subunit. {ECO:0000269|PubMed:21520375};
Function Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C- terminus of several proteins having the C-terminal sequence Cys- aliphatic-aliphatic-X. {ECO:0000269|PubMed:21520375}.
Similarity Belongs to the protein prenyltransferase subunit beta family. {ECO:0000305}.
Similarity Contains 5 PFTB repeats. {ECO:0000305}.
Subunit Heterodimer of FNTA and FNTB. {ECO:0000269|PubMed:21520375}.

Identical and Related Proteins

Unique RefSeq proteins for LMP004358 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22122343 RefSeq NP_666039 437 protein farnesyltransferase subunit beta

Identical Sequences to LMP004358 proteins

Reference Database Accession Length Protein Name
GI:22122343 GenBank AAH31417.1 437 Farnesyltransferase, CAAX box, beta [Mus musculus]
GI:22122343 SwissProt Q8K2I1.1 437 RecName: Full=Protein farnesyltransferase subunit beta; Short=FTase-beta; AltName: Full=CAAX farnesyltransferase subunit beta; AltName: Full=Ras proteins prenyltransferase subunit beta [Mus musculus]

Related Sequences to LMP004358 proteins

Reference Database Accession Length Protein Name
GI:22122343 GenBank EDL36446.1 617 mCG7924, partial [Mus musculus]
GI:22122343 GenBank EDL39492.1 437 mCG1047264 [Mus musculus]
GI:22122343 PDB 1FPP 437 Chain B, Protein Farnesyltransferase Complex With Farnesyl Diphosphate
GI:22122343 PDB 1QBQ 437 Chain B, Structure Of Rat Farnesyl Protein Transferase Complexed With A Cvim Peptide And Alpha-Hydroxyfarnesylphosphonic Acid.
GI:22122343 PDB 1D8D 437 Chain B, Co-Crystal Structure Of Rat Protein Farnesyltransferase Complexed With A K-Ras4b Peptide Substrate And Fpp Analog At 2.0a Resolution
GI:22122343 RefSeq XP_006543609.1 437 PREDICTED: protein farnesyltransferase subunit beta-like [Mus musculus]