Gene/Proteome Database (LMPD)

LMPD ID
LMP004382
Gene ID
Species
Mus musculus (Mouse)
Gene Name
branched chain ketoacid dehydrogenase E1, beta polypeptide
Gene Symbol
Synonyms
-
Alternate Names
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; BCKDE1B; BCKDH E1-beta; branched-chain alpha-keto acid dehydrogenase E1 component beta chain
Chromosome
9
Map Location
9 E2|9
EC Number
1.2.4.4

Proteins

2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
Refseq ID NP_954665
Protein GI 40353220
UniProt ID Q6P3A8
mRNA ID NM_199195
Length 322
RefSeq Status PROVISIONAL
MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY

Gene Information

Entrez Gene ID
Gene Name
branched chain ketoacid dehydrogenase E1, beta polypeptide
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005947 ISS:HGNC C mitochondrial alpha-ketoglutarate dehydrogenase complex
GO:0005743 TAS:MGI C mitochondrial inner membrane
GO:0005739 ISS:HGNC C mitochondrion
GO:0003863 IEA:UniProtKB-EC F 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity
GO:0003826 IDA:MGI F alpha-ketoacid dehydrogenase activity
GO:0009083 ISS:HGNC P branched-chain amino acid catabolic process
GO:0009063 TAS:MGI P cellular amino acid catabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-6 Leucine Catabolism
PWY3DJ-0 isoleucine degradation

REACTOME Pathway Links

REACTOME Pathway ID Description
5892792 Branched-chain amino acid catabolism

Domain Information

InterPro Annotations

Accession Description
IPR029061 Thiamin diphosphate-binding fold
IPR005476 Transketolase, C-terminal
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II
IPR005475 Transketolase-like, pyrimidine-binding domain

UniProt Annotations

Entry Information

Gene Name
branched chain ketoacid dehydrogenase E1, beta polypeptide
Protein Entry
ODBB_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6P3A8-1; Sequence=Displayed; Name=2; IsoId=Q6P3A8-2; Sequence=VSP_029841; Note=No experimental confirmation available.;
Catalytic Activity 3-methyl-2-oxobutanoate + [dihydrolipoyllysine-residue (2-methylpropanoyl)transferase] lipoyllysine = [dihydrolipoyllysine-residue (2- methylpropanoyl)transferase] S-(2- methylpropanoyl)dihydrolipoyllysine + CO(2).
Function The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Subcellular Location Mitochondrion matrix.
Subunit Heterotetramer of 2 alpha and 2 beta chains. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP004382 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
40353220 RefSeq NP_954665 322 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial

Identical Sequences to LMP004382 proteins

Reference Database Accession Length Protein Name
GI:40353220 GenBank AAH64099.1 322 Branched chain ketoacid dehydrogenase E1, beta polypeptide [Mus musculus]

Related Sequences to LMP004382 proteins

Reference Database Accession Length Protein Name
GI:40353220 GenBank EDL77651.1 390 branched chain keto acid dehydrogenase E1, beta polypeptide [Rattus norvegicus]
GI:40353220 GenBank AGU32431.1 390 Sequence 118 from patent US 8507277
GI:40353220 PIR - 390 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) - mouse [Mus musculus]
GI:40353220 RefSeq NP_062140.1 390 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor [Rattus norvegicus]
GI:40353220 RefSeq XP_006510848.1 390 PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial isoform X1 [Mus musculus]
GI:40353220 SwissProt P35738.3 390 RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; AltName: Full=Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; Short=BCKDE1B; Short=BCKDH E1-beta; Flags: Precursor [Rattus norvegicus]