Gene/Proteome Database (LMPD)
Proteins
| secretoglobin, family 1B, member 27 precursor | |
|---|---|
| Refseq ID | NP_033726 |
| Protein GI | 39930319 |
| UniProt ID | Q91WB5 |
| mRNA ID | NM_009596 |
| Length | 92 |
| RefSeq Status | PROVISIONAL |
| MKLTGALLLLGAALLLISEGDCGLCPALQRKVDLFLNGTTEEYVEYLKQFNENTKVLENAANIKKCSDRTLTEEDKAQATSLINKITASRTC | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2216 peptide sequence: MKLTGALLLLGAALLLISEGDC | |
Gene Information
Entrez Gene ID
Gene Name
secretoglobin, family 1B, member 27
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:MGI | C | cytoplasm |
| GO:0005576 | IDA:MGI | C | extracellular region |
| GO:0005496 | IPI:MGI | F | steroid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
secretoglobin, family 1B, member 27
Protein Entry
Q91WB5_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP004993 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 39930319 | RefSeq | NP_033726 | 92 | secretoglobin, family 1B, member 27 precursor |
Identical Sequences to LMP004993 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39930319 | GenBank | AAH16132.1 | 92 | Androgen binding protein alpha [Mus musculus] |
| GI:39930319 | GenBank | AAD30166.2 | 92 | androgen-binding protein alpha subunit [Mus musculus domesticus] |
| GI:39930319 | GenBank | AAI32437.1 | 92 | Androgen binding protein alpha [Mus musculus] |
| GI:39930319 | GenBank | ADB46066.1 | 92 | androgen-binding protein, partial [Mus musculus] |
| GI:39930319 | GenBank | AIQ80449.1 | 92 | ABPA27 [Mus musculus] |
Related Sequences to LMP004993 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39930319 | GenBank | AAM08254.1 | 70 | salivary androgen-binding protein alpha subunit, partial [Mus spicilegus] |
| GI:39930319 | GenBank | AAM08255.1 | 70 | salivary androgen-binding protein alpha subunit, partial [Mus macedonicus] |
| GI:39930319 | GenBank | EDL03048.1 | 75 | androgen binding protein alpha, isoform CRA_b [Mus musculus] |
| GI:39930319 | GenBank | AIQ80450.1 | 92 | ABPA26 [Mus musculus] |
| GI:39930319 | PRF | - | 72 | androgen-binding protein:SUBUNIT=alpha [Mus musculus] |
| GI:39930319 | RefSeq | NP_001092800.1 | 92 | androgen binding protein (Abp) family member precursor [Mus musculus] |