Gene/Proteome Database (LMPD)
LMPD ID
LMP005046
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Symbol
Synonyms
PRO7177; SIAT7C; ST6GALNACIII; STY
Alternate Names
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; SIAT7-C; ST6GALNAC III; sialyltransferase 7C; GalNAc alpha-2,6-sialyltransferase III; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltran; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) C
Chromosome
1
Map Location
1p31.1
EC Number
2.4.99.-
Summary
ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 1 | |
---|---|
Refseq ID | NP_694541 |
Protein GI | 229892273 |
UniProt ID | Q8NDV1 |
mRNA ID | NM_152996 |
Length | 305 |
RefSeq Status | VALIDATED |
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFLLAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWTLS |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 2 | |
---|---|
Refseq ID | NP_001153483 |
Protein GI | 229892275 |
UniProt ID | Q8NDV1 |
mRNA ID | NM_001160011 |
Length | 210 |
RefSeq Status | VALIDATED |
MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDSTE |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008373 | IDA:BHF-UCL | F | sialyltransferase activity |
GO:0009100 | IDA:BHF-UCL | P | glycoprotein metabolic process |
GO:0006687 | IDA:BHF-UCL | P | glycosphingolipid metabolic process |
GO:0006677 | IDA:BHF-UCL | P | glycosylceramide metabolic process |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
GO:0097503 | IDA:GOC | P | sialylation |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_200727 | O-linked glycosylation |
REACT_115606 | O-linked glycosylation of mucins |
REACT_200874 | Sialic acid metabolism |
REACT_115835 | Termination of O-glycan biosynthesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Protein Entry
SIA7C_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8NDV1-1; Sequence=Displayed; Name=2; IsoId=Q8NDV1-2; Sequence=VSP_013218, VSP_013219; |
Catalytic Activity | CMP-N-acetylneuraminate + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,3-(N-acetyl-D- galactosaminyl)-glycoprotein = CMP + alpha-N-acetylneuraminyl-2,3- beta-D-galactosyl-(2,6-alpha-N-acetylneuraminyl)-(N-acetyl-D- galactosaminyl)-glycoprotein. |
Function | Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. ST6GalNAcIII prefers glycolipids to glycoproteins (By similarity). |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 29 family. |
Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST6GalNAc III; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_632"; |
Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST6GALNAC3"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP005046 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
229892273 | RefSeq | NP_694541 | 305 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 1 |
229892275 | RefSeq | NP_001153483 | 210 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 2 |
Identical Sequences to LMP005046 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229892273 | EMBL | CAD45371.1 | 305 | alpha 2,6-sialyltransferase [Homo sapiens] |
GI:229892275 | GenBank | ADI54150.1 | 210 | Sequence 536 from patent US 7423120 |
GI:229892275 | GenBank | ADL73347.1 | 210 | Sequence 536 from patent US 7696319 |
GI:229892275 | GenBank | ADL91517.1 | 210 | Sequence 536 from patent US 7709602 |
GI:229892275 | GenBank | ADL91827.1 | 210 | Sequence 536 from patent US 7709603 |
GI:229892275 | GenBank | ADL97908.1 | 210 | Sequence 536 from patent US 7718770 |
GI:229892275 | GenBank | AEU55355.1 | 210 | Sequence 536 from patent US 8063186 |
GI:229892273 | SwissProt | Q8NDV1.1 | 305 | RecName: Full=Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; AltName: Full=GalNAc alpha-2,6-sialyltransferase III; AltName: Full=ST6GalNAc III; Short=ST6GalNAcIII; AltName: Full=STY; AltName: Full=Sialyltransferase 7C; Short=SIAT7-C [Homo sapiens] |
Related Sequences to LMP005046 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229892273 | DBBJ | BAC03611.1 | 305 | unnamed protein product [Homo sapiens] |
GI:229892275 | EMBL | CAD45371.1 | 305 | alpha 2,6-sialyltransferase [Homo sapiens] |
GI:229892273 | EMBL | CAS91684.1 | 305 | unnamed protein product [Homo sapiens] |
GI:229892273 | GenBank | ABA66708.1 | 305 | Sequence 2350 from patent US 6943241 |
GI:229892273 | GenBank | ACH32638.1 | 305 | Sequence 7118 from patent US 7411051 |
GI:229892275 | GenBank | ACH32638.1 | 305 | Sequence 7118 from patent US 7411051 |
GI:229892273 | GenBank | ACH35518.1 | 305 | Sequence 10008 from patent US 7411051 |
GI:229892273 | GenBank | AHD77390.1 | 305 | Sequence 22523 from patent US 8586006 |
GI:229892275 | RefSeq | NP_694541.2 | 305 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform 1 [Homo sapiens] |
GI:229892275 | RefSeq | XP_008958181.1 | 246 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X2 [Pan paniscus] |
GI:229892275 | RefSeq | XP_010345734.1 | 210 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 isoform X2 [Saimiri boliviensis boliviensis] |
GI:229892275 | SwissProt | Q8NDV1.1 | 305 | RecName: Full=Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; AltName: Full=GalNAc alpha-2,6-sialyltransferase III; AltName: Full=ST6GalNAc III; Short=ST6GalNAcIII; AltName: Full=STY; AltName: Full=Sialyltransferase 7C; Short=SIAT7-C [Homo sapiens] |