Gene/Proteome Database (LMPD)

LMPD ID
LMP005085
Gene ID
84649
Species
Homo sapiens (Human)
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
DGAT2
Synonyms
ARAT; GS1999FULL
Alternate Names
diacylglycerol O-acyltransferase 2; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2
Chromosome
11
Map Location
11q13.5
EC Number
2.3.1.20
Summary
This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Orthologs
View orthologs and multiple alignments for DGAT2

Proteins

diacylglycerol O-acyltransferase 2 isoform 1
Refseq ID NP_115953
Protein GI 26024197
UniProt ID Q96PD7
mRNA ID NM_032564
Length 388
RefSeq Status VALIDATED
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
diacylglycerol O-acyltransferase 2 isoform 2
Refseq ID NP_001240820
Protein GI 359806523
UniProt ID Q96PD7
mRNA ID NM_001253891
Length 345
RefSeq Status VALIDATED
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

Gene Information

Entrez Gene ID
84649
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
DGAT2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:BHF-UCL C endoplasmic reticulum
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0030176 ISS:BHF-UCL C integral component of endoplasmic reticulum membrane
GO:0016021 IDA:BHF-UCL C integral component of membrane
GO:0005811 IEA:UniProtKB-KW C lipid particle
GO:0005739 IEA:Ensembl C mitochondrion
GO:0048471 ISS:BHF-UCL C perinuclear region of cytoplasm
GO:0003846 IEA:Ensembl F 2-acylglycerol O-acyltransferase activity
GO:0004144 IDA:UniProtKB F diacylglycerol O-acyltransferase activity
GO:0042803 ISS:BHF-UCL F protein homodimerization activity
GO:0050252 IEA:UniProtKB-EC F retinol O-fatty-acyltransferase activity
GO:0036155 TAS:Reactome P acylglycerol acyl-chain remodeling
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0071400 ISS:BHF-UCL P cellular response to oleic acid
GO:0035356 ISS:BHF-UCL P cellular triglyceride homeostasis
GO:0042632 ISS:BHF-UCL P cholesterol homeostasis
GO:0046339 IDA:BHF-UCL P diacylglycerol metabolic process
GO:0060613 ISS:BHF-UCL P fat pad development
GO:0055089 ISS:BHF-UCL P fatty acid homeostasis
GO:0006071 IEA:UniProtKB-KW P glycerol metabolic process
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0019915 ISS:BHF-UCL P lipid storage
GO:0035336 IDA:BHF-UCL P long-chain fatty-acyl-CoA metabolic process
GO:0034383 ISS:BHF-UCL P low-density lipoprotein particle clearance
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0097006 ISS:BHF-UCL P regulation of plasma lipoprotein particle levels
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0019432 IDA:UniProtKB P triglyceride biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa00561 Glycerolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121122 Acyl chain remodeling of DAG and TAG

Domain Information

InterPro Annotations

Accession Description
IPR007130 Diacylglycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
diacylglycerol O-acyltransferase 2
Protein Entry
DGAT2_HUMAN
UniProt ID
Q96PD7
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96PD7-1; Sequence=Displayed; Name=2; IsoId=Q96PD7-2; Sequence=VSP_020356;
Catalytic Activity Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.
Catalytic Activity Acyl-CoA + retinol = CoA + retinyl ester.
Enzyme Regulation Inhibited by niacin.
Function Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides (By similarity). Functions also as an acyl-CoA retinol acyltransferase (ARAT).
Pathway Glycerolipid metabolism; triacylglycerol biosynthesis.
Sequence Caution Sequence=BAD38635.1; Type=Erroneous initiation; Evidence= ; Sequence=CAD38961.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the diacylglycerol acyltransferase family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein {ECO
Subunit Forms multimeric complexes consisting of several DGAT2 subunits.
Tissue Specificity Predominantly expressed in liver and white adipose tissue. Expressed at lower level in mammary gland, testis and peripheral blood leukocytes. Expressed in sebaceous glands of normal skin but decreased psoriatic skin.

Identical and Related Proteins

Unique RefSeq proteins for LMP005085 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
26024197 RefSeq NP_115953 388 diacylglycerol O-acyltransferase 2 isoform 1
359806523 RefSeq NP_001240820 345 diacylglycerol O-acyltransferase 2 isoform 2

Identical Sequences to LMP005085 proteins

Reference Database Accession Length Protein Name
GI:26024197 GenBank JAA40103.1 388 diacylglycerol O-acyltransferase 2 [Pan troglodytes]
GI:26024197 GenBank AGC98166.1 388 Sequence 10 from patent US 8334111
GI:26024197 GenBank AGX59583.1 388 Sequence 19445 from patent US 8541208
GI:26024197 GenBank AGX72248.1 388 Sequence 44295 from patent US 8541208
GI:26024197 GenBank AIC52594.1 388 DGAT2, partial [synthetic construct]
GI:26024197 RefSeq XP_004051883.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 isoform 1 [Gorilla gorilla gorilla]
GI:359806523 RefSeq XP_004051884.1 345 PREDICTED: diacylglycerol O-acyltransferase 2 isoform 2 [Gorilla gorilla gorilla]

Related Sequences to LMP005085 proteins

Reference Database Accession Length Protein Name
GI:359806523 EMBL CAD38961.1 434 hypothetical protein, partial [Homo sapiens]
GI:26024197 EMBL CAD38961.1 434 hypothetical protein, partial [Homo sapiens]
GI:359806523 EMBL CBV04422.1 388 unnamed protein product [Homo sapiens]
GI:359806523 EMBL CBU92416.1 388 unnamed protein product [Homo sapiens]
GI:359806523 GenBank ADI54048.1 388 Sequence 336 from patent US 7423120
GI:26024197 GenBank EHH23259.1 388 hypothetical protein EGK_06694 [Macaca mulatta]
GI:26024197 GenBank EHH56595.1 388 hypothetical protein EGM_06043 [Macaca fascicularis]
GI:359806523 GenBank AGC98166.1 388 Sequence 10 from patent US 8334111
GI:26024197 RefSeq XP_003910483.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Papio anubis]
GI:359806523 RefSeq XP_005579177.1 345 PREDICTED: diacylglycerol O-acyltransferase 2 isoform X3 [Macaca fascicularis]
GI:26024197 RefSeq XP_008018378.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 [Chlorocebus sabaeus]
GI:26024197 RefSeq XP_010365090.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 [Rhinopithecus roxellana]