Gene/Proteome Database (LMPD)

LMPD ID
LMP005280
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cytochrome P450, family 4, subfamily a, polypeptide 12a
Gene Symbol
Synonyms
BC025936; Cyp4a12
Chromosome
4
Map Location
4 D1|4 52.91 cM

Proteins

cytochrome P450 4A12A
Refseq ID NP_803125
Protein GI 86198312
UniProt ID Q91WL5
mRNA ID NM_177406
Length 508
RefSeq Status VALIDATED
MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKANGSYRFLAPWIGRGLLMLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVMLDKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ

Gene Information

Entrez Gene ID
Gene Name
cytochrome P450, family 4, subfamily a, polypeptide 12a
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0018685 IDA:MGI F alkane 1-monooxygenase activity
GO:0070330 IEA:UniProtKB-EC F aromatase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 ISS:UniProtKB F monooxygenase activity
GO:0006631 ISS:UniProtKB P fatty acid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 4, subfamily a, polypeptide 12a
Protein Entry
Q91WL5_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ;
Function Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Induction P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.
Sequence Caution Sequence=BAE25803.1; Type=Frameshift; Positions=492; Evidence= ;
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP005280 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
86198312 RefSeq NP_803125 508 cytochrome P450 4A12A

Identical Sequences to LMP005280 proteins

Reference Database Accession Length Protein Name
GI:86198312 GenBank EDL30651.1 508 mCG141485 [Mus musculus]
GI:86198312 SwissProt Q91WL5.2 508 RecName: Full=Cytochrome P450 4A12A; AltName: Full=CYPIVA12 [Mus musculus]

Related Sequences to LMP005280 proteins

Reference Database Accession Length Protein Name
GI:86198312 GenBank AAH14721.1 508 Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus]
GI:86198312 GenBank AAH25936.1 508 Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus]
GI:86198312 GenBank AAH26582.1 508 Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus]
GI:86198312 GenBank AAH31141.1 508 Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus]
GI:86198312 GenBank AAH33924.1 508 Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus]
GI:86198312 GenBank ABP29760.1 508 Sequence 4775 from patent US 7193069