Gene/Proteome Database (LMPD)
Proteins
cytochrome P450 4A12A | |
---|---|
Refseq ID | NP_803125 |
Protein GI | 86198312 |
UniProt ID | Q91WL5 |
mRNA ID | NM_177406 |
Length | 508 |
RefSeq Status | VALIDATED |
MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKANGSYRFLAPWIGRGLLMLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVMLDKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 4, subfamily a, polypeptide 12a
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016020 | IEA:UniProtKB-KW | C | membrane |
GO:0018685 | IDA:MGI | F | alkane 1-monooxygenase activity |
GO:0070330 | IEA:UniProtKB-EC | F | aromatase activity |
GO:0020037 | IEA:InterPro | F | heme binding |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0004497 | ISS:UniProtKB | F | monooxygenase activity |
GO:0006631 | ISS:UniProtKB | P | fatty acid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 4, subfamily a, polypeptide 12a
Protein Entry
Q91WL5_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O. |
Cofactor | Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ; |
Function | Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. |
Induction | P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens. |
Sequence Caution | Sequence=BAE25803.1; Type=Frameshift; Positions=492; Evidence= ; |
Similarity | Belongs to the cytochrome P450 family. |
Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005280 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
86198312 | RefSeq | NP_803125 | 508 | cytochrome P450 4A12A |
Identical Sequences to LMP005280 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:86198312 | GenBank | EDL30651.1 | 508 | mCG141485 [Mus musculus] |
GI:86198312 | SwissProt | Q91WL5.2 | 508 | RecName: Full=Cytochrome P450 4A12A; AltName: Full=CYPIVA12 [Mus musculus] |
Related Sequences to LMP005280 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:86198312 | GenBank | AAH14721.1 | 508 | Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus] |
GI:86198312 | GenBank | AAH25936.1 | 508 | Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus] |
GI:86198312 | GenBank | AAH26582.1 | 508 | Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus] |
GI:86198312 | GenBank | AAH31141.1 | 508 | Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus] |
GI:86198312 | GenBank | AAH33924.1 | 508 | Cytochrome P450, family 4, subfamily a, polypeptide 12a [Mus musculus] |
GI:86198312 | GenBank | ABP29760.1 | 508 | Sequence 4775 from patent US 7193069 |