Gene/Proteome Database (LMPD)

LMPD ID
LMP005370
Gene ID
22629
Species
Mus musculus (Mouse)
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Gene Symbol
Ywhah
Synonyms
-
Alternate Names
14-3-3 protein eta; 14-3-3 eta
Chromosome
5
Map Location
5 B1|5

Proteins

14-3-3 protein eta
Refseq ID NP_035868
Protein GI 6756037
UniProt ID P68510
mRNA ID NM_011738
Length 246
RefSeq Status VALIDATED
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Gene Information

Entrez Gene ID
22629
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Gene Symbol
Ywhah
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:MGI C cytoplasm
GO:0030659 TAS:Reactome C cytoplasmic vesicle membrane
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0014704 IC:BHF-UCL C intercalated disc
GO:0005886 IEA:Ensembl C plasma membrane
GO:0003779 IDA:ProtInc F actin binding
GO:0035259 ISS:UniProtKB F glucocorticoid receptor binding
GO:0044325 IPI:BHF-UCL F ion channel binding
GO:0019904 IDA:MGI F protein domain specific binding
GO:0017080 ISS:BHF-UCL F sodium channel regulator activity
GO:0007010 NAS:ProtInc P cytoskeleton organization
GO:0006713 ISS:UniProtKB P glucocorticoid catabolic process
GO:0042921 ISS:UniProtKB P glucocorticoid receptor signaling pathway
GO:0006886 IDA:MGI P intracellular protein transport
GO:0086010 ISS:BHF-UCL P membrane depolarization during action potential
GO:0043066 NAS:ProtInc P negative regulation of apoptotic process
GO:0050774 IDA:MGI P negative regulation of dendrite morphogenesis
GO:0045893 ISS:UniProtKB P positive regulation of transcription, DNA-templated
GO:0007088 NAS:ProtInc P regulation of mitosis
GO:2000649 ISS:BHF-UCL P regulation of sodium ion transmembrane transporter activity
GO:0002028 ISS:BHF-UCL P regulation of sodium ion transport
GO:0021762 IEA:Ensembl P substantia nigra development

KEGG Pathway Links

KEGG Pathway ID Description
mmu05169 Epstein-Barr virus infection
mmu04390 Hippo signaling pathway
mmu04151 PI3K-Akt signaling pathway
mmu05203 Viral carcinogenesis

Domain Information

InterPro Annotations

Accession Description
IPR000308 14-3-3 protein
IPR023409 14-3-3 protein, conserved site
IPR023410 14-3-3_domain

UniProt Annotations

Entry Information

Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Protein Entry
1433F_MOUSE
UniProt ID
P68510
Species
Mouse

Comments

Comment Type Description
Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1 (By similarity). {ECO:0000250}.
Interaction Q5S006:Lrrk2; NbExp=4; IntAct=EBI-444641, EBI-2693710; Q9WVS6:Park2; NbExp=8; IntAct=EBI-444641, EBI-973635; O55042:Snca; NbExp=2; IntAct=EBI-444641, EBI-2310271; P21580:TNFAIP3 (xeno); NbExp=3; IntAct=EBI-444641, EBI-527670;
Ptm Phosphorylated on Ser-59 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion. {ECO:0000269|PubMed:9705322}.
Similarity Belongs to the 14-3-3 family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Homodimer (By similarity). Interacts with many nuclear hormone receptors and cofactors including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP and THRA. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Weakly interacts with CDKN1B (By similarity). Interacts with ARHGEF28 and CDK16. Interacts with KCNK18 in a phosphorylation-dependent manner. Interacts with SAMSN1. Interacts with the 'Ser-241' phosphorylated form of PDPK1 (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005370 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6756037 RefSeq NP_035868 246 14-3-3 protein eta

Identical Sequences to LMP005370 proteins

Reference Database Accession Length Protein Name
GI:6756037 GenBank ERE87880.1 246 14-3-3 protein eta-like protein [Cricetulus griseus]
GI:6756037 RefSeq XP_006747755.1 246 PREDICTED: 14-3-3 protein eta [Leptonychotes weddellii]
GI:6756037 RefSeq XP_007952144.1 246 PREDICTED: 14-3-3 protein eta [Orycteropus afer afer]
GI:6756037 RefSeq XP_008564636.1 246 PREDICTED: 14-3-3 protein eta isoform X1 [Galeopterus variegatus]
GI:6756037 RefSeq XP_008564637.1 246 PREDICTED: 14-3-3 protein eta isoform X2 [Galeopterus variegatus]
GI:6756037 RefSeq XP_008839214.1 246 PREDICTED: 14-3-3 protein eta [Nannospalax galili]

Related Sequences to LMP005370 proteins

Reference Database Accession Length Protein Name
GI:6756037 GenBank AAI02983.1 246 Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide [Bos taurus]
GI:6756037 GenBank ACK44253.1 246 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (predicted) [Oryctolagus cuniculus]
GI:6756037 RefSeq NP_776917.2 246 14-3-3 protein eta [Bos taurus]
GI:6756037 RefSeq NP_001164827.1 246 14-3-3 protein eta [Oryctolagus cuniculus]
GI:6756037 RefSeq XP_005288677.1 247 PREDICTED: 14-3-3 protein eta [Chrysemys picta bellii]
GI:6756037 RefSeq XP_007061633.1 247 PREDICTED: 14-3-3 protein eta [Chelonia mydas]