Gene/Proteome Database (LMPD)

LMPD ID
LMP005576
Gene ID
170755
Species
Mus musculus (Mouse)
Gene Name
serum/glucocorticoid regulated kinase 3
Gene Symbol
Sgk3
Synonyms
2510015P22Rik; A330005P07Rik; Cisk; fy; fz
Alternate Names
serine/threonine-protein kinase Sgk3; cytokine-independent survival kinase; serum/glucocorticoid-regulated kinase 3
Chromosome
1
Map Location
1 A2|1 2.08 cM
EC Number
2.7.11.1

Proteins

serine/threonine-protein kinase Sgk3
Refseq ID NP_573483
Protein GI 18959280
UniProt ID Q9ERE3
mRNA ID NM_133220
Length 496
RefSeq Status VALIDATED
MQRDCIMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL
serine/threonine-protein kinase Sgk3
Refseq ID NP_001032848
Protein GI 83649757
UniProt ID Q9ERE3
mRNA ID NM_001037759
Length 496
RefSeq Status VALIDATED
Protein sequence is identical to GI:18959280 (mRNA isoform)
serine/threonine-protein kinase Sgk3
Refseq ID NP_808215
Protein GI 83649753
UniProt ID Q9ERE3
mRNA ID NM_177547
Length 496
RefSeq Status VALIDATED
Protein sequence is identical to GI:18959280 (mRNA isoform)

Gene Information

Entrez Gene ID
170755
Gene Name
serum/glucocorticoid regulated kinase 3
Gene Symbol
Sgk3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016023 IDA:MGI C cytoplasmic membrane-bounded vesicle
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0035091 IEA:InterPro F phosphatidylinositol binding
GO:0004674 IDA:MGI F protein serine/threonine kinase activity
GO:2001240 IDA:MGI P negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

KEGG Pathway Links

KEGG Pathway ID Description
mmu04068 FoxO signaling pathway
ko04151 PI3K-Akt signaling pathway
mmu04151 PI3K-Akt signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5894103 Stimuli-sensing channels

Domain Information

InterPro Annotations

Accession Description
IPR000961 AGC-kinase, C-terminal
IPR001683 Phox homologous domain
IPR017441 Protein kinase, ATP binding site
IPR017892 Protein kinase, C-terminal
IPR000719 Protein kinase domain
IPR011009 Protein kinase-like domain
IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain
IPR008271 Serine/threonine-protein kinase, active site

UniProt Annotations

Entry Information

Gene Name
serum/glucocorticoid regulated kinase 3
Protein Entry
SGK3_MOUSE
UniProt ID
Q9ERE3
Species
Mouse

Comments

Comment Type Description
Catalytic Activity ATP + a protein = ADP + a phosphoprotein.
Enzyme Regulation Two specific sites, one in the kinase domain (Thr-320) and the other in the C-terminal regulatory region (Ser- 486), need to be phosphorylated for its full activation.
Function Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, proliferation, survival and migration. Up-regulates Na(+) channels: SCNN1A/ENAC and SCN5A, K(+) channels: KCNA3/KV1.3, KCNE1, KCNQ1 and KCNH2/HERG, epithelial Ca(2+) channels: TRPV5 and TRPV6, chloride channel: BSND, creatine transporter: SLC6A8, Na(+)/dicarboxylate cotransporter: SLC13A2/NADC1, Na(+)-dependent phosphate cotransporter: SLC34A2/NAPI-2B, amino acid transporters: SLC1A5/ASCT2 and SLC6A19, glutamate transporters: SLC1A3/EAAT1, SLC1A6/EAAT4 and SLC1A7/EAAT5, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase. Plays a role in the regulation of renal tubular phosphate transport and bone density. Phosphorylates NEDD4L and GSK3B. Positively regulates ER transcription activity through phosphorylation of FLII. Negatively regulates the function of ITCH/AIP4 via its phosphorylation and thereby prevents CXCR4 from being efficiently sorted to lysosomes. {ECO:0000269|PubMed:15774535, ECO:0000269|PubMed:15774536, ECO:0000269|PubMed:21113728, ECO:0000269|PubMed:21451460, ECO:0000269|PubMed:21865597}.
Ptm Activated by phosphorylation on Ser-486 by an unknown kinase (may be mTORC2 but not confirmed), transforming it into a substrate for PDPK1 which then phosphorylates it on Thr-320. {ECO:0000250}.
Similarity Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. {ECO:0000305}.
Similarity Contains 1 AGC-kinase C-terminal domain. {ECO:0000305}.
Similarity Contains 1 protein kinase domain. {ECO:0000255|PROSITE-ProRule:PRU00159}.
Similarity Contains 1 PX (phox homology) domain. {ECO:0000255|PROSITE-ProRule:PRU00147}.
Subcellular Location Cytoplasmic vesicle {ECO:0000269|PubMed:21865597}. Early endosome {ECO:0000269|PubMed:21865597}. Recycling endosome {ECO:0000250}. Note=Endosomal localization is a prerequisite for complete kinase activity. It is essential for its colocalization with the kinase responsible for phosphorylating Ser-486 thus allowing PDPK1 phosphorylation of Thr-320 resulting in complete activation of SGK3. Colocalizes with SLC9A3/NHE3 in the recycling endosomes (By similarity). Localized in vesicle-like structures and in the early endosome. {ECO:0000250}.
Subunit Interacts with GSK3B and FLII. Interacts with PDPK1 in a phosphorylation-dependent manner. {ECO:0000250}.
Tissue Specificity Widely expressed, predominantly in the heart, spleen and 7-day embryo.

Identical and Related Proteins

Unique RefSeq proteins for LMP005576 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18959280 RefSeq NP_573483 496 serine/threonine-protein kinase Sgk3

Identical Sequences to LMP005576 proteins

Reference Database Accession Length Protein Name
GI:18959280 DBBJ BAE42262.1 496 unnamed protein product [Mus musculus]
GI:18959280 DBBJ BAE42298.1 496 unnamed protein product [Mus musculus]
GI:18959280 GenBank ABK42426.1 496 Sgk3 [synthetic construct]
GI:18959280 GenBank EDL14292.1 496 mCG131353, isoform CRA_a [Mus musculus]
GI:18959280 RefSeq NP_808215.2 496 serine/threonine-protein kinase Sgk3 [Mus musculus]
GI:18959280 RefSeq NP_001032848.1 496 serine/threonine-protein kinase Sgk3 [Mus musculus]

Related Sequences to LMP005576 proteins

Reference Database Accession Length Protein Name
GI:18959280 DBBJ BAC27349.1 496 unnamed protein product [Mus musculus]
GI:18959280 DBBJ BAE30755.1 496 unnamed protein product [Mus musculus]
GI:18959280 RefSeq XP_003754029.1 496 PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Rattus norvegicus]
GI:18959280 RefSeq XP_007634262.1 496 PREDICTED: serine/threonine-protein kinase Sgk3 isoform X2 [Cricetulus griseus]
GI:18959280 RefSeq XP_007634263.1 496 PREDICTED: serine/threonine-protein kinase Sgk3 isoform X2 [Cricetulus griseus]
GI:18959280 SwissProt Q8R4V0.2 496 RecName: Full=Serine/threonine-protein kinase Sgk3; AltName: Full=Cytokine-independent survival kinase; AltName: Full=Serum/glucocorticoid-regulated kinase 3; AltName: Full=Serum/glucocorticoid-regulated kinase-like [Rattus norvegicus]