Gene/Proteome Database (LMPD)
LMPD ID
LMP005773
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glutathione peroxidase 3
Gene Symbol
Synonyms
AA960521; EGPx; GPx; GSHPx-3; GSHPx-P
Alternate Names
glutathione peroxidase 3; GPx-3; GPx-P; plasma GPx; extracellular GPx; plasma glutathione peroxidase
Chromosome
11
Map Location
11|11 B3-B5
EC Number
1.11.1.9
Summary
This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This gene is highly expressed in the kidney where it may play a role in protecting the kidney from oxidative damage. [provided by RefSeq, Feb 2012]
Orthologs
Proteins
| glutathione peroxidase 3 precursor | |
|---|---|
| Refseq ID | NP_032187 |
| Protein GI | 15011841 |
| UniProt ID | P46412 |
| mRNA ID | NM_008161 |
| Length | 226 |
| RefSeq Status | REVIEWED |
| MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK | |
| sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2512 peptide sequence: MARILRASCLLSLLLAGFVPPGRG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005615 | ISS:UniProtKB | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0004602 | ISS:UniProtKB | F | glutathione peroxidase activity |
| GO:0008430 | ISS:UniProtKB | F | selenium binding |
| GO:0042744 | IDA:MGI | P | hydrogen peroxide catabolic process |
| GO:0051289 | ISS:UniProtKB | P | protein homotetramerization |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu04918 | Thyroid hormone synthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
| Function | Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. |
| Similarity | Belongs to the glutathione peroxidase family. {ECO:0000305}. |
| Subcellular Location | Secreted. |
| Subunit | Homotetramer. |
| Tissue Specificity | Secreted in plasma. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005773 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15011841 | RefSeq | NP_032187 | 226 | glutathione peroxidase 3 precursor |
Identical Sequences to LMP005773 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15011841 | DBBJ | BAE27413.1 | 226 | unnamed protein product [Mus musculus] |
| GI:15011841 | GenBank | AAH49235.1 | 226 | Glutathione peroxidase 3 [Mus musculus] |
| GI:15011841 | GenBank | AAH61950.1 | 226 | Glutathione peroxidase 3 [Mus musculus] |
| GI:15011841 | GenBank | AAH03339.1 | 226 | Glutathione peroxidase 3 [Mus musculus] |
| GI:15011841 | GenBank | AAH37027.1 | 226 | Glutathione peroxidase 3 [Mus musculus] |
| GI:15011841 | SwissProt | P46412.2 | 226 | RecName: Full=Glutathione peroxidase 3; Short=GPx-3; Short=GSHPx-3; AltName: Full=Plasma glutathione peroxidase; Short=GPx-P; Short=GSHPx-P; Flags: Precursor [Mus musculus] |
Related Sequences to LMP005773 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15011841 | DBBJ | BAA00587.2 | 226 | plasma glutathione peroxidase precursor [Rattus norvegicus] |
| GI:15011841 | GenBank | AAH62227.1 | 226 | Glutathione peroxidase 3 [Rattus norvegicus] |
| GI:15011841 | RefSeq | NP_071970.2 | 226 | glutathione peroxidase 3 precursor [Rattus norvegicus] |
| GI:15011841 | RefSeq | XP_006984930.1 | 226 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 3 [Peromyscus maniculatus bairdii] |
| GI:15011841 | RefSeq | XP_008850098.1 | 226 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 3 [Nannospalax galili] |
| GI:15011841 | SwissProt | P23764.2 | 226 | RecName: Full=Glutathione peroxidase 3; Short=GPx-3; Short=GSHPx-3; AltName: Full=Plasma glutathione peroxidase; Short=GPx-P; Short=GSHPx-P; Flags: Precursor [Rattus norvegicus] |