Gene/Proteome Database (LMPD)
Proteins
| acyl-CoA-binding domain-containing protein 7 | |
|---|---|
| Refseq ID | NP_001034933 |
| Protein GI | 89886362 |
| UniProt ID | Q8N6N7 |
| mRNA ID | NM_001039844 |
| Length | 88 |
| RefSeq Status | VALIDATED |
| MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI | |
Gene Information
Entrez Gene ID
Gene Name
acyl-CoA binding domain containing 7
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000062 | IEA:InterPro | F | fatty-acyl-CoA binding |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
acyl-CoA binding domain containing 7
Protein Entry
ACBD7_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Binds medium- and long-chain acyl-CoA esters. |
| Similarity | Belongs to the ACBD7 family. |
| Similarity | Contains 1 ACB (acyl-CoA-binding) domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005776 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 89886362 | RefSeq | NP_001034933 | 88 | acyl-CoA-binding domain-containing protein 7 |
Identical Sequences to LMP005776 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:89886362 | DBBJ | BAG53080.1 | 88 | unnamed protein product [Homo sapiens] |
| GI:89886362 | GenBank | ABP28187.1 | 88 | Sequence 3202 from patent US 7193069 |
| GI:89886362 | GenBank | ADZ15342.1 | 88 | acyl-Coenzyme A binding domain containing 7, partial [synthetic construct] |
| GI:89886362 | GenBank | AHE00485.1 | 88 | Sequence 53442 from patent US 8586006 |
| GI:89886362 | GenBank | AHE00486.1 | 88 | Sequence 53443 from patent US 8586006 |
| GI:89886362 | GenBank | AIC58285.1 | 88 | ACBD7, partial [synthetic construct] |
Related Sequences to LMP005776 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:89886362 | PDB | 3EPY | 89 | Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 7 Complexed With Palmitoyl-Coa |
| GI:89886362 | PDB | 3EPY | 89 | Chain B, Crystal Structure Of Human Acyl-Coa Binding Domain 7 Complexed With Palmitoyl-Coa |
| GI:89886362 | RefSeq | XP_002820594.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 [Pongo abelii] |
| GI:89886362 | RefSeq | XP_003257722.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 [Nomascus leucogenys] |
| GI:89886362 | RefSeq | XP_003831239.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 [Pan paniscus] |
| GI:89886362 | RefSeq | XP_004049134.1 | 88 | PREDICTED: acyl-CoA-binding domain-containing protein 7 [Gorilla gorilla gorilla] |