Gene/Proteome Database (LMPD)
Proteins
| G-protein coupled receptor 6 isoform a | |
|---|---|
| Refseq ID | NP_001273028 |
| Protein GI | 554790381 |
| UniProt ID | P46095 |
| mRNA ID | NM_001286099 |
| Length | 377 |
| RefSeq Status | VALIDATED |
| MTLLAWCTRGANPAAMNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV | |
| G-protein coupled receptor 6 isoform b | |
|---|---|
| Refseq ID | NP_005275 |
| Protein GI | 4885341 |
| UniProt ID | P46095 |
| mRNA ID | NM_005284 |
| Length | 362 |
| RefSeq Status | VALIDATED |
| MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005887 | TAS:ProtInc | C | integral component of plasma membrane |
| GO:0004930 | TAS:ProtInc | F | G-protein coupled receptor activity |
| GO:0007186 | TAS:ProtInc | P | G-protein coupled receptor signaling pathway |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P46095-1; Sequence=Displayed; Name=2; IsoId=P46095-2; Sequence=VSP_055105; |
| Caution | Was originally (PubMed:12220620) thought to be a receptor for sphingosine 1-phosphate. It has been demonstrated that it is not the case (PubMed:19286662). {ECO |
| Function | Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity). |
| Similarity | Belongs to the G-protein coupled receptor 1 family. |
| Subcellular Location | Cell membrane ; Multi-pass membrane protein . Note=Detected in the intracellular compartments. It is currently unclear whether this is a cell surface or intracellular receptor. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005782 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 554790381 | RefSeq | NP_001273028 | 377 | G-protein coupled receptor 6 isoform a |
| 4885341 | RefSeq | NP_005275 | 362 | G-protein coupled receptor 6 isoform b |
Identical Sequences to LMP005782 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885341 | GenBank | AHD70849.1 | 362 | Sequence 4317 from patent US 8586006 |
| GI:4885341 | GenBank | AIC48868.1 | 362 | GPR6, partial [synthetic construct] |
| GI:4885341 | GenBank | AIC63013.1 | 362 | GPR6, partial [synthetic construct] |
| GI:4885341 | RefSeq | XP_518685.3 | 362 | PREDICTED: G-protein coupled receptor 6 [Pan troglodytes] |
| GI:4885341 | RefSeq | XP_003805553.1 | 362 | PREDICTED: G-protein coupled receptor 6 isoform X2 [Pan paniscus] |
| GI:554790381 | RefSeq | XP_003805555.1 | 377 | PREDICTED: G-protein coupled receptor 6 isoform X1 [Pan paniscus] |
| GI:4885341 | RefSeq | XP_009450099.1 | 362 | PREDICTED: G-protein coupled receptor 6 [Pan troglodytes] |
Related Sequences to LMP005782 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:554790381 | DBBJ | BAG58241.1 | 377 | unnamed protein product [Homo sapiens] |
| GI:4885341 | GenBank | ACC03250.1 | 376 | Sequence 45 from patent US 7332292 |
| GI:4885341 | RefSeq | XP_003255606.1 | 362 | PREDICTED: G-protein coupled receptor 6 isoform 1 [Nomascus leucogenys] |
| GI:554790381 | RefSeq | XP_003255607.1 | 370 | PREDICTED: G-protein coupled receptor 6 isoform 2 [Nomascus leucogenys] |
| GI:4885341 | RefSeq | XP_003255607.1 | 370 | PREDICTED: G-protein coupled receptor 6 isoform 2 [Nomascus leucogenys] |
| GI:4885341 | RefSeq | XP_003255608.1 | 362 | PREDICTED: G-protein coupled receptor 6 isoform 3 [Nomascus leucogenys] |
| GI:4885341 | RefSeq | XP_003805555.1 | 377 | PREDICTED: G-protein coupled receptor 6 isoform X1 [Pan paniscus] |
| GI:554790381 | RefSeq | XP_003936010.1 | 378 | PREDICTED: G-protein coupled receptor 6 isoform X1 [Saimiri boliviensis boliviensis] |
| GI:554790381 | RefSeq | XP_004044563.1 | 370 | PREDICTED: G-protein coupled receptor 6 isoform 2 [Gorilla gorilla gorilla] |
| GI:554790381 | RefSeq | XP_004044564.1 | 391 | PREDICTED: G-protein coupled receptor 6 isoform 3 [Gorilla gorilla gorilla] |
| GI:4885341 | RefSeq | NP_001273028.1 | 377 | G-protein coupled receptor 6 isoform a [Homo sapiens] |
| GI:554790381 | RefSeq | XP_010364315.1 | 420 | PREDICTED: G-protein coupled receptor 6 isoform X1 [Rhinopithecus roxellana] |