Gene/Proteome Database (LMPD)

LMPD ID
LMP005782
Gene ID
Species
Homo sapiens (Human)
Gene Name
G protein-coupled receptor 6
Gene Symbol
Synonyms
-
Chromosome
6
Map Location
6q21

Proteins

G-protein coupled receptor 6 isoform a
Refseq ID NP_001273028
Protein GI 554790381
UniProt ID P46095
mRNA ID NM_001286099
Length 377
RefSeq Status VALIDATED
MTLLAWCTRGANPAAMNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
G-protein coupled receptor 6 isoform b
Refseq ID NP_005275
Protein GI 4885341
UniProt ID P46095
mRNA ID NM_005284
Length 362
RefSeq Status VALIDATED
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV

Gene Information

Entrez Gene ID
Gene Name
G protein-coupled receptor 6
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0004930 TAS:ProtInc F G-protein coupled receptor activity
GO:0007186 TAS:ProtInc P G-protein coupled receptor signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000723 G protein-coupled receptor 3/6/12 orphan
IPR001151 G protein-coupled receptor 6
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
G protein-coupled receptor 6
Protein Entry
GPR6_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P46095-1; Sequence=Displayed; Name=2; IsoId=P46095-2; Sequence=VSP_055105;
Caution Was originally (PubMed:12220620) thought to be a receptor for sphingosine 1-phosphate. It has been demonstrated that it is not the case (PubMed:19286662). {ECO
Function Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity).
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Cell membrane ; Multi-pass membrane protein . Note=Detected in the intracellular compartments. It is currently unclear whether this is a cell surface or intracellular receptor.

Identical and Related Proteins

Unique RefSeq proteins for LMP005782 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
554790381 RefSeq NP_001273028 377 G-protein coupled receptor 6 isoform a
4885341 RefSeq NP_005275 362 G-protein coupled receptor 6 isoform b

Identical Sequences to LMP005782 proteins

Reference Database Accession Length Protein Name
GI:4885341 GenBank AHD70849.1 362 Sequence 4317 from patent US 8586006
GI:4885341 GenBank AIC48868.1 362 GPR6, partial [synthetic construct]
GI:4885341 GenBank AIC63013.1 362 GPR6, partial [synthetic construct]
GI:4885341 RefSeq XP_518685.3 362 PREDICTED: G-protein coupled receptor 6 [Pan troglodytes]
GI:4885341 RefSeq XP_003805553.1 362 PREDICTED: G-protein coupled receptor 6 isoform X2 [Pan paniscus]
GI:554790381 RefSeq XP_003805555.1 377 PREDICTED: G-protein coupled receptor 6 isoform X1 [Pan paniscus]
GI:4885341 RefSeq XP_009450099.1 362 PREDICTED: G-protein coupled receptor 6 [Pan troglodytes]

Related Sequences to LMP005782 proteins

Reference Database Accession Length Protein Name
GI:554790381 DBBJ BAG58241.1 377 unnamed protein product [Homo sapiens]
GI:4885341 GenBank ACC03250.1 376 Sequence 45 from patent US 7332292
GI:4885341 RefSeq XP_003255606.1 362 PREDICTED: G-protein coupled receptor 6 isoform 1 [Nomascus leucogenys]
GI:554790381 RefSeq XP_003255607.1 370 PREDICTED: G-protein coupled receptor 6 isoform 2 [Nomascus leucogenys]
GI:4885341 RefSeq XP_003255607.1 370 PREDICTED: G-protein coupled receptor 6 isoform 2 [Nomascus leucogenys]
GI:4885341 RefSeq XP_003255608.1 362 PREDICTED: G-protein coupled receptor 6 isoform 3 [Nomascus leucogenys]
GI:4885341 RefSeq XP_003805555.1 377 PREDICTED: G-protein coupled receptor 6 isoform X1 [Pan paniscus]
GI:554790381 RefSeq XP_003936010.1 378 PREDICTED: G-protein coupled receptor 6 isoform X1 [Saimiri boliviensis boliviensis]
GI:554790381 RefSeq XP_004044563.1 370 PREDICTED: G-protein coupled receptor 6 isoform 2 [Gorilla gorilla gorilla]
GI:554790381 RefSeq XP_004044564.1 391 PREDICTED: G-protein coupled receptor 6 isoform 3 [Gorilla gorilla gorilla]
GI:4885341 RefSeq NP_001273028.1 377 G-protein coupled receptor 6 isoform a [Homo sapiens]
GI:554790381 RefSeq XP_010364315.1 420 PREDICTED: G-protein coupled receptor 6 isoform X1 [Rhinopithecus roxellana]