Gene/Proteome Database (LMPD)

LMPD ID
LMP005910
Gene ID
79888
Species
Homo sapiens (Human)
Gene Name
lysophosphatidylcholine acyltransferase 1
Gene Symbol
LPCAT1
Synonyms
AYTL2; PFAAP3; lpcat
Alternate Names
lysophosphatidylcholine acyltransferase 1; LPCAT-1; lysoPAFAT; LPC acyltransferase 1; acyltransferase like 2; acyltransferase-like 2; lysoPC acyltransferase 1; lyso-PAF acetyltransferase; regulated by phosphonoformate; acetyl-CoA:lyso-PAF acetyltransferase; phosphonoformate immuno-associated protein 3; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 1; acetyl-CoA:lyso-platelet-activating factor acetyltransferase
Chromosome
5
Map Location
5p15.33
EC Number
2.3.1.23
Summary
Lysophosphatidylcholine (LPC) acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis (Nakanishi et al., 2006 [PubMed 16704971]).[supplied by OMIM, May 2008]
Orthologs
View orthologs and multiple alignments for LPCAT1

Proteins

lysophosphatidylcholine acyltransferase 1
Refseq ID NP_079106
Protein GI 33946291
UniProt ID Q8NF37
mRNA ID NM_024830
Length 534
RefSeq Status VALIDATED
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD

Gene Information

Entrez Gene ID
79888
Gene Name
lysophosphatidylcholine acyltransferase 1
Gene Symbol
LPCAT1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005811 IDA:UniProtKB C lipid particle
GO:0016020 IDA:UniProtKB C membrane
GO:0047184 IDA:UniProtKB F 1-acylglycerophosphocholine O-acyltransferase activity
GO:0047159 IEA:Ensembl F 1-alkenylglycerophosphocholine O-acyltransferase activity
GO:0047192 IEA:UniProtKB-EC F 1-alkylglycerophosphocholine O-acetyltransferase activity
GO:0047191 IEA:Ensembl F 1-alkylglycerophosphocholine O-acyltransferase activity
GO:0005509 IEA:InterPro F calcium ion binding
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:2001246 IEA:Ensembl P negative regulation of phosphatidylcholine biosynthetic process
GO:0006654 TAS:Reactome P phosphatidic acid biosynthetic process
GO:0036151 IDA:UniProtKB P phosphatidylcholine acyl-chain remodeling
GO:0036148 TAS:Reactome P phosphatidylglycerol acyl-chain remodeling
GO:0008654 ISS:UniProtKB P phospholipid biosynthetic process
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0045732 IEA:Ensembl P positive regulation of protein catabolic process
GO:0060041 IEA:Ensembl P retina development in camera-type eye
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0043129 IEA:Ensembl P surfactant homeostasis
GO:0019432 TAS:Reactome P triglyceride biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00565 Ether lipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_120829 Acyl chain remodelling of PC
REACT_121324 Acyl chain remodelling of PG
REACT_120906 Synthesis of PA

Domain Information

InterPro Annotations

Accession Description
IPR002048 EF-hand domain
IPR011992 EF-hand domain pair
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
lysophosphatidylcholine acyltransferase 1
Protein Entry
PCAT1_HUMAN
UniProt ID
Q8NF37
Species
Human

Comments

Comment Type Description
Catalytic Activity Acetyl-CoA + 1-alkyl-sn-glycero-3- phosphocholine = CoA + 2-acetyl-1-alkyl-sn-glycero-3- phosphocholine.
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine.
Domain The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
Enzyme Regulation Not activated by inflammatory stimulation. Inhibited by Cu(2+) and Fe(2+). Activity is not affected by Co(2+), Mg(2+) or Mn(2+) (By similarity).
Function Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent. Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology.
Pathway Lipid metabolism; phospholipid metabolism.
Sequence Caution Sequence=BAB14061.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAB14065.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ;
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Similarity Contains 2 EF-hand domains. {ECO
Subcellular Location Endoplasmic reticulum membrane ; Single-pass type II membrane protein . Golgi apparatus membrane ; Single-pass type II membrane protein . Lipid droplet . Note=May adopt a monotopic topology when embedded in the lipid monolayer of the lipid droplet, with both termini exposed to the cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP005910 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
33946291 RefSeq NP_079106 534 lysophosphatidylcholine acyltransferase 1

Identical Sequences to LMP005910 proteins

Reference Database Accession Length Protein Name
GI:33946291 DBBJ BAG73362.1 534 lysophosphatidylcholine acyltransferase 1, partial [synthetic construct]
GI:33946291 GenBank AAI40368.1 534 Lysophosphatidylcholine acyltransferase 1, partial [synthetic construct]
GI:33946291 GenBank ADA20522.1 534 Sequence 2346 from patent US 7608413
GI:33946291 GenBank AED35447.1 534 Sequence 96 from patent US 7879989
GI:33946291 GenBank AEN36418.1 534 Sequence 2346 from patent US 7998689
GI:33946291 SwissProt Q8NF37.2 534 RecName: Full=Lysophosphatidylcholine acyltransferase 1; Short=LPC acyltransferase 1; Short=LPCAT-1; Short=LysoPC acyltransferase 1; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; AltName: Full=1-alkylglycerophosphocholine O-acetyltransferase; AltName: Full=Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Short=Acetyl-CoA:lyso-PAF acetyltransferase; Short=Lyso-PAF acetyltransferase; Short=LysoPAFAT; AltName: Full=Acyltransferase-like 2; AltName: Full=Phosphonoformate immuno-associated protein 3 [Homo sapiens]

Related Sequences to LMP005910 proteins

Reference Database Accession Length Protein Name
GI:33946291 GenBank JAA10288.1 534 lysophosphatidylcholine acyltransferase 1 [Pan troglodytes]
GI:33946291 GenBank JAA20066.1 534 lysophosphatidylcholine acyltransferase 1 [Pan troglodytes]
GI:33946291 GenBank JAA30789.1 534 lysophosphatidylcholine acyltransferase 1 [Pan troglodytes]
GI:33946291 GenBank JAA41056.1 534 lysophosphatidylcholine acyltransferase 1 [Pan troglodytes]
GI:33946291 RefSeq XP_517613.2 537 PREDICTED: lysophosphatidylcholine acyltransferase 1 [Pan troglodytes]
GI:33946291 RefSeq XP_002815437.1 534 PREDICTED: lysophosphatidylcholine acyltransferase 1 isoform X1 [Pongo abelii]