Gene/Proteome Database (LMPD)
LMPD ID
LMP006077
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glycerophosphodiester phosphodiesterase 1
Gene Symbol
Synonyms
1200003M13Rik; Mir16; RGS16
Alternate Names
glycerophosphodiester phosphodiesterase 1; membrane interacting protein of RGS16; membrane-interacting protein of RGS16
Chromosome
7
Map Location
7|7 F3
EC Number
3.1.4.44
Proteins
| glycerophosphodiester phosphodiesterase 1 | |
|---|---|
| Refseq ID | NP_062526 |
| Protein GI | 9625018 |
| UniProt ID | Q9JL56 |
| mRNA ID | NM_019580 |
| Length | 331 |
| RefSeq Status | PROVISIONAL |
| MWLWEDQGGLLGPFSFVLVLLLVVTRSPFNACVLTGSLYILLRFFSFEPVPSRRALQVLKPRDRVSAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNTVDRTTDGSGRLCDLTFEQVRKLNPAANHRLRNEFPDERIPTLKEAVTECLRHNLTIFFDVKGHADMASAALKNIYTEFPQLYNNSMVCSFLPEVIYKMRQTDQKVITALTHRPWSLSHTGDGKPRYSVFWKQSVFVVLDILLDWSMHNVLWYLCGISAFLMQKDFVSPDYLKKWSAKGIQVVSWTVNTFDEKNYYESHLGSSYITDSMLEDCAPHF | |
Gene Information
Entrez Gene ID
Gene Name
glycerophosphodiester phosphodiesterase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005887 | ISS:MGI | C | integral component of plasma membrane |
| GO:0008889 | ISS:MGI | F | glycerophosphodiester phosphodiesterase activity |
| GO:0047395 | IEA:UniProtKB-EC | F | glycerophosphoinositol glycerophosphodiesterase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0007186 | ISO:MGI | P | G-protein coupled receptor signaling pathway |
| GO:0006071 | IEA:InterPro | P | glycerol metabolic process |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycerophosphodiester phosphodiesterase 1
Protein Entry
GDE1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 1-(sn-glycero-3-phospho)-1D-myo-inositol + H(2)O = myo-inositol + sn-glycerol 3-phosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; |
| Function | Has glycerophosphoinositol phosphodiesterase activity. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways (By similarity). {ECO:0000250}. |
| Ptm | N-glycosylated. {ECO:0000250}. |
| Similarity | Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}. |
| Similarity | Contains 1 GP-PDE domain. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000250}. Membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Note=Perinuclear vesicles and cell membrane. {ECO:0000250}. |
| Subunit | Interacts with PRAF2 and RGS16. {ECO:0000250}. |
| Tissue Specificity | Widely expressed. {ECO:0000269|PubMed:10760272}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006077 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 9625018 | RefSeq | NP_062526 | 331 | glycerophosphodiester phosphodiesterase 1 |
Identical Sequences to LMP006077 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9625018 | DBBJ | BAB23975.1 | 331 | unnamed protein product [Mus musculus] |
| GI:9625018 | GenBank | AAF65232.1 | 331 | membrane interacting protein of RGS16 [Mus musculus] |
| GI:9625018 | GenBank | AAH03902.1 | 331 | Glycerophosphodiester phosphodiesterase 1 [Mus musculus] |
| GI:9625018 | GenBank | EDL17137.1 | 331 | membrane interacting protein of RGS16, isoform CRA_c [Mus musculus] |
| GI:9625018 | SwissProt | Q9JL56.1 | 331 | RecName: Full=Glycerophosphodiester phosphodiesterase 1; AltName: Full=Membrane-interacting protein of RGS16 [Mus musculus] |
Related Sequences to LMP006077 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9625018 | DBBJ | BAE29870.1 | 331 | unnamed protein product [Mus musculus] |
| GI:9625018 | GenBank | AAF65233.1 | 331 | membrane interacting protein of RGS16 [Rattus norvegicus] |
| GI:9625018 | GenBank | AAH70897.1 | 331 | Glycerophosphodiester phosphodiesterase 1 [Rattus norvegicus] |
| GI:9625018 | GenBank | EDM17698.1 | 331 | membrane interacting protein of RGS16, isoform CRA_b [Rattus norvegicus] |
| GI:9625018 | RefSeq | NP_116004.2 | 331 | glycerophosphodiester phosphodiesterase 1 [Rattus norvegicus] |
| GI:9625018 | SwissProt | Q9JL55.2 | 331 | RecName: Full=Glycerophosphodiester phosphodiesterase 1; AltName: Full=Membrane-interacting protein of RGS16 [Rattus norvegicus] |