Gene/Proteome Database (LMPD)
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 2 | |
|---|---|
| Refseq ID | NP_081998 |
| Protein GI | 169808397 |
| UniProt ID | Q4FJR0 |
| mRNA ID | NM_027722 |
| Length | 179 |
| RefSeq Status | VALIDATED |
| MKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTNGNSSVPSLPDNNALFVTAAPPSGVPSSIR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008486 | IEA:Ensembl | F | diphosphoinositol-polyphosphate diphosphatase activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Protein Entry
NUDT4_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP006085 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 169808397 | RefSeq | NP_081998 | 179 | diphosphoinositol polyphosphate phosphohydrolase 2 |
Identical Sequences to LMP006085 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:169808397 | EMBL | CAJ18550.1 | 179 | Nudt4 [Mus musculus] |
| GI:169808397 | GenBank | AAH27209.1 | 179 | Nudt4 protein [Mus musculus] |
| GI:169808397 | GenBank | EDL21611.1 | 179 | nudix (nucleoside diphosphate linked moiety X)-type motif 4, isoform CRA_b [Mus musculus] |
| GI:169808397 | SwissProt | Q8R2U6.1 | 179 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 2; Short=DIPP-2; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; AltName: Full=Nucleoside diphosphate-linked moiety X motif 4; Short=Nudix motif 4 [Mus musculus] |
Related Sequences to LMP006085 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:169808397 | DBBJ | BAB30582.1 | 179 | unnamed protein product [Mus musculus] |
| GI:169808397 | DBBJ | BAC33229.1 | 179 | unnamed protein product [Mus musculus] |
| GI:169808397 | GenBank | EDM16850.1 | 179 | rCG48717, isoform CRA_a [Rattus norvegicus] |
| GI:169808397 | GenBank | ERE91447.1 | 179 | diphosphoinositol polyphosphate phosphohydrolase 2-like protein [Cricetulus griseus] |
| GI:169808397 | RefSeq | XP_006514179.1 | 180 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Mus musculus] |
| GI:169808397 | SwissProt | Q99MY2.1 | 179 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 2; Short=DIPP-2; Short=rDIPP2; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2; AltName: Full=Nucleoside diphosphate-linked moiety X motif 4; Short=Nudix motif 4 [Rattus norvegicus] |