Gene/Proteome Database (LMPD)

LMPD ID
LMP006124
Gene ID
2846
Species
Homo sapiens (Human)
Gene Name
lysophosphatidic acid receptor 4
Gene Symbol
LPAR4
Synonyms
GPR23; LPA4; P2RY9; P2Y5-LIKE; P2Y9
Alternate Names
lysophosphatidic acid receptor 4; LPA-4; LPA receptor 4; P2Y purinoceptor 9; P2Y5-like receptor; purinergic receptor 9; G protein-coupled receptor 23; G-protein coupled receptor 23
Chromosome
X
Map Location
Xq21.1
Summary
This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation. [provided by RefSeq, Feb 2009]
Orthologs
View orthologs and multiple alignments for LPAR4

Proteins

lysophosphatidic acid receptor 4
Refseq ID NP_001264929
Protein GI 487439767
UniProt ID Q99677
mRNA ID NM_001278000
Length 370
RefSeq Status REVIEWED
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
lysophosphatidic acid receptor 4
Refseq ID NP_005287
Protein GI 4885311
UniProt ID Q99677
mRNA ID NM_005296
Length 370
RefSeq Status REVIEWED
Protein sequence is identical to GI:487439767 (mRNA isoform)

Gene Information

Entrez Gene ID
2846
Gene Name
lysophosphatidic acid receptor 4
Gene Symbol
LPAR4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0004930 TAS:ProtInc F G-protein coupled receptor activity
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0007186 TAS:ProtInc P G-protein coupled receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
hsa04151 PI3K-Akt signaling pathway
hsa04015 Rap1 signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_18289 P2Y receptors

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
lysophosphatidic acid receptor 4
Protein Entry
LPAR4_HUMAN
UniProt ID
Q99677
Species
Human

Comments

Comment Type Description
Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1- alkyl- > 1-alkenyl-LPA.
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Tissue Specificity High expression in ovary. Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus and hippocampus.

Identical and Related Proteins

Unique RefSeq proteins for LMP006124 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
487439767 RefSeq NP_001264929 370 lysophosphatidic acid receptor 4

Identical Sequences to LMP006124 proteins

Reference Database Accession Length Protein Name
GI:487439767 GenBank ADC00679.1 370 Sequence 176 from patent US 7629453
GI:487439767 GenBank ADC20158.1 370 Sequence 379 from patent US 7638288
GI:487439767 GenBank ADF14074.1 370 Sequence 1 from patent US 7666611
GI:487439767 GenBank AGD01119.1 370 Sequence 379 from patent US 8338124
GI:487439767 RefSeq XP_005262183.1 370 PREDICTED: lysophosphatidic acid receptor 4 isoform X1 [Homo sapiens]
GI:487439767 RefSeq XP_006724702.1 370 PREDICTED: lysophosphatidic acid receptor 4 isoform X2 [Homo sapiens]

Related Sequences to LMP006124 proteins

Reference Database Accession Length Protein Name
GI:487439767 GenBank AAH95538.1 370 Lysophosphatidic acid receptor 4 [Homo sapiens]
GI:487439767 RefSeq XP_003317579.1 370 PREDICTED: lysophosphatidic acid receptor 4 [Pan troglodytes]
GI:487439767 RefSeq XP_003317580.1 370 PREDICTED: lysophosphatidic acid receptor 4 [Pan troglodytes]
GI:487439767 RefSeq XP_009437563.1 370 PREDICTED: lysophosphatidic acid receptor 4 [Pan troglodytes]
GI:487439767 RefSeq XP_009437564.1 370 PREDICTED: lysophosphatidic acid receptor 4 [Pan troglodytes]
GI:487439767 RefSeq XP_009437565.1 370 PREDICTED: lysophosphatidic acid receptor 4 [Pan troglodytes]