Gene/Proteome Database (LMPD)

LMPD ID
LMP006150
Gene ID
2876
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 1
Gene Symbol
GPX1
Synonyms
GPXD; GSHPX1
Alternate Names
glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase
Chromosome
3
Map Location
3p21.3
EC Number
1.11.1.9
Summary
This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for GPX1

Proteins

glutathione peroxidase 1 isoform 1
Refseq ID NP_000572
Protein GI 41406084
UniProt ID P07203
mRNA ID NM_000581
Length 203
RefSeq Status REVIEWED
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
glutathione peroxidase 1 isoform 2
Refseq ID NP_958799
Protein GI 41406084
UniProt ID P07203
mRNA ID NM_201397
Length 203
RefSeq Status REVIEWED
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

Gene Information

Entrez Gene ID
2876
Gene Name
glutathione peroxidase 1
Gene Symbol
GPX1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:BHF-UCL C cytoplasm
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0005759 TAS:Reactome C mitochondrial matrix
GO:0005739 IDA:BHF-UCL C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0017124 IPI:BHF-UCL F SH3 domain binding
GO:0043295 IEA:Ensembl F glutathione binding
GO:0004602 IDA:BHF-UCL F glutathione peroxidase activity
GO:0047066 IEA:Ensembl F phospholipid-hydroperoxide glutathione peroxidase activity
GO:0008430 IEA:Ensembl F selenium binding
GO:0009650 IMP:BHF-UCL P UV protection
GO:0007568 IEA:Ensembl P aging
GO:0060055 IEA:Ensembl P angiogenesis involved in wound healing
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0043534 IEA:Ensembl P blood vessel endothelial cell migration
GO:0045454 IDA:BHF-UCL P cell redox homeostasis
GO:0034599 NAS:ParkinsonsUK-UCL P cellular response to oxidative stress
GO:0001885 IEA:Ensembl P endothelial cell development
GO:0045444 IEA:Ensembl P fat cell differentiation
GO:0006749 IDA:BHF-UCL P glutathione metabolic process
GO:0060047 IMP:BHF-UCL P heart contraction
GO:0042744 IDA:BHF-UCL P hydrogen peroxide catabolic process
GO:0051702 IEA:Ensembl P interaction with symbiont
GO:0008631 IEA:Ensembl P intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0019372 TAS:Reactome P lipoxygenase pathway
GO:0051450 IEA:Ensembl P myoblast proliferation
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0043154 IMP:BHF-UCL P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1902042 IMP:BHF-UCL P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0002862 IEA:Ensembl P negative regulation of inflammatory response to antigenic stimulus
GO:1902176 IEA:Ensembl P negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:0090201 IMP:BHF-UCL P negative regulation of release of cytochrome c from mitochondria
GO:0055086 TAS:Reactome P nucleobase-containing small molecule metabolic process
GO:1902905 ISS:ParkinsonsUK-UCL P positive regulation of fibril organization
GO:0051897 IEA:Ensembl P positive regulation of protein kinase B signaling
GO:0018158 IEA:Ensembl P protein oxidation
GO:0006144 TAS:Reactome P purine nucleobase metabolic process
GO:0006195 TAS:Reactome P purine nucleotide catabolic process
GO:0040029 IDA:BHF-UCL P regulation of gene expression, epigenetic
GO:0033599 IMP:BHF-UCL P regulation of mammary gland epithelial cell proliferation
GO:0043523 IEA:Ensembl P regulation of neuron apoptotic process
GO:0061136 IDA:BHF-UCL P regulation of proteasomal protein catabolic process
GO:0032355 IEA:Ensembl P response to estradiol
GO:0051593 IEA:Ensembl P response to folic acid
GO:0010332 IEA:Ensembl P response to gamma radiation
GO:0009749 IEA:Ensembl P response to glucose
GO:0042542 IMP:BHF-UCL P response to hydrogen peroxide
GO:0006982 IEA:Ensembl P response to lipid hydroperoxide
GO:0035094 IEA:Ensembl P response to nicotine
GO:0010269 IMP:BHF-UCL P response to selenium ion
GO:0009609 IEA:Ensembl P response to symbiotic bacterium
GO:0009636 IEA:Ensembl P response to toxic substance
GO:0009410 IEA:Ensembl P response to xenobiotic stimulus
GO:0007605 IEA:Ensembl P sensory perception of sound
GO:0048741 IEA:Ensembl P skeletal muscle fiber development
GO:0043403 IEA:Ensembl P skeletal muscle tissue regeneration
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0001659 IEA:Ensembl P temperature homeostasis
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0042311 IEA:Ensembl P vasodilation

KEGG Pathway Links

KEGG Pathway ID Description
hsa04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 1
Protein Entry
GPX1_HUMAN
UniProt ID
P07203
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P07203-1; Sequence=Displayed; Name=2; IsoId=P07203-2; Sequence=VSP_047369, VSP_047370; Note=Gene prediction based on EST data.;
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Protects the hemoglobin in erythrocytes from oxidative breakdown.
Ptm During periods of oxidative stress, Sec-49 may react with a superoxide radical, irreversibly lose hydroselenide and be converted to dehydroalanine.
Similarity Belongs to the glutathione peroxidase family.
Subcellular Location Cytoplasm.
Subunit Homotetramer. Interacts with MIEN1.
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx1/";
Web Resource Name=Wikipedia; Note=Glutathione peroxidase entry; URL="http://en.wikipedia.org/wiki/Glutathione_peroxidase";

Identical and Related Proteins

Unique RefSeq proteins for LMP006150 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41406084 RefSeq NP_000572 203 glutathione peroxidase 1 isoform 1
41406084 RefSeq NP_958799 203 glutathione peroxidase 1 isoform 2

Identical Sequences to LMP006150 proteins

Reference Database Accession Length Protein Name
GI:41406084 GenBank AAP80181.1 203 glutathione peroxidase 1 [Homo sapiens]
GI:41406084 GenBank AAP80181.1 203 glutathione peroxidase 1 [Homo sapiens]
GI:41406084 GenBank AAH00742.3 203 Glutathione peroxidase 1 [Homo sapiens]
GI:41406084 GenBank AAH00742.3 203 Glutathione peroxidase 1 [Homo sapiens]
GI:41406084 GenBank AAH07865.2 203 Glutathione peroxidase 1 [Homo sapiens]
GI:41406084 GenBank AAH07865.2 203 Glutathione peroxidase 1 [Homo sapiens]
GI:41406084 SwissProt P07203.4 203 RecName: Full=Glutathione peroxidase 1; Short=GPx-1; Short=GSHPx-1; AltName: Full=Cellular glutathione peroxidase [Homo sapiens]
GI:41406084 SwissProt P07203.4 203 RecName: Full=Glutathione peroxidase 1; Short=GPx-1; Short=GSHPx-1; AltName: Full=Cellular glutathione peroxidase [Homo sapiens]

Related Sequences to LMP006150 proteins

Reference Database Accession Length Protein Name
GI:41406084 EMBL CAA31993.1 201 unnamed protein product [Homo sapiens]
GI:41406084 EMBL CAA31993.1 201 unnamed protein product [Homo sapiens]
GI:41406084 EMBL CAB37833.1 201 glutathione peroxidase [Homo sapiens]
GI:41406084 EMBL CAB37833.1 201 glutathione peroxidase [Homo sapiens]
GI:41406084 GenBank AAA75389.2 201 glutathione peroxidase [Homo sapiens]
GI:41406084 GenBank AAA75389.2 201 glutathione peroxidase [Homo sapiens]
GI:41406084 GenBank AAV20605.1 201 Sequence 865 from patent US 6753314
GI:41406084 GenBank AAV20605.1 201 Sequence 865 from patent US 6753314
GI:41406084 GenBank AEN28183.1 201 Sequence 17 from patent US 7993826
GI:41406084 GenBank AEN28183.1 201 Sequence 17 from patent US 7993826
GI:41406084 RefSeq NP_001070980.2 201 glutathione peroxidase 1 [Pan troglodytes]
GI:41406084 RefSeq NP_001070980.2 201 glutathione peroxidase 1 [Pan troglodytes]