Gene/Proteome Database (LMPD)

LMPD ID
LMP006329
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cholesterol 25-hydroxylase
Gene Symbol
Synonyms
AI462618; m25OH
Alternate Names
cholesterol 25-hydroxylase; cholesterol 25-monooxygenase
Chromosome
19
Map Location
19 C1|19
EC Number
1.14.99.38

Proteins

cholesterol 25-hydroxylase
Refseq ID NP_034020
Protein GI 6857769
UniProt ID Q9Z0F5
mRNA ID NM_009890
Length 298
RefSeq Status PROVISIONAL
MGCYNGSELQDLGCSSQLLLQPLWDTIRTREAFTRSPIFPVTFSIITYVGFCLPFVVLDVLYPWVPILRRYKIHPDFSPSVKQLLPCLGLTLYQHLVFVFPVTLLHWVRSPALLPQEAPELVQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLTIFTFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT

Gene Information

Entrez Gene ID
Gene Name
cholesterol 25-hydroxylase
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0001567 IEA:UniProtKB-EC F cholesterol 25-hydroxylase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0008395 IDA:MGI F steroid hydroxylase activity
GO:0008203 IDA:MGI P cholesterol metabolic process
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00120 Primary bile acid biosynthesis
mmu00120 Primary bile acid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893440 Synthesis of bile acids and bile salts

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
cholesterol 25-hydroxylase
Protein Entry
CH25H_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Cholesterol + AH(2) + O(2) = 25- hydroxycholesterol + A + H(2)O. {ECO:0000269|PubMed:9852097}.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000269|PubMed:9852097};
Disruption Phenotype Mice do not display any apparent alteration in bile acid synthesis and cholesterol metabolism. {ECO:0000269|PubMed:12543708}.
Function Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes. May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. In testis, production of 25- hydroxycholesterol by macrophages may play a role in Leydig cell differentiation. {ECO:0000269|PubMed:9852097}.
Ptm N-glycosylated. {ECO:0000269|PubMed:9852097}.
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:9852097}; Multi-pass membrane protein {ECO:0000269|PubMed:9852097}.
Tissue Specificity Widely expressed at low level and at higher level in the lung. Weakly expressed in the heart, lung and kidney. {ECO:0000269|PubMed:9852097}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006329 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6857769 RefSeq NP_034020 298 cholesterol 25-hydroxylase

Identical Sequences to LMP006329 proteins

Reference Database Accession Length Protein Name
GI:6857769 DBBJ BAE24352.1 298 unnamed protein product [Mus musculus]
GI:6857769 DBBJ BAE31482.1 298 unnamed protein product [Mus musculus]
GI:6857769 EMBL CAR81283.1 298 unnamed protein product [Mus musculus]
GI:6857769 EMBL CBX84761.1 298 unnamed protein product [Mus musculus]
GI:6857769 GenBank EDL41749.1 298 cholesterol 25-hydroxylase [Mus musculus]
GI:6857769 SwissProt Q9Z0F5.1 298 RecName: Full=Cholesterol 25-hydroxylase; AltName: Full=Cholesterol 25-monooxygenase; Short=m25OH [Mus musculus]

Related Sequences to LMP006329 proteins

Reference Database Accession Length Protein Name
GI:6857769 DBBJ BAE35945.1 298 unnamed protein product [Mus musculus]
GI:6857769 EMBL CAR81327.1 298 unnamed protein product [Mus musculus]
GI:6857769 EMBL CAR81339.1 298 unnamed protein product [Mus musculus]
GI:6857769 EMBL CBX84805.1 298 unnamed protein product [Mus musculus]
GI:6857769 EMBL CBX84815.1 298 unnamed protein product [Mus musculus]
GI:6857769 GenBank AAH39919.1 298 Cholesterol 25-hydroxylase [Mus musculus]