Gene/Proteome Database (LMPD)
Proteins
cholesterol 25-hydroxylase | |
---|---|
Refseq ID | NP_034020 |
Protein GI | 6857769 |
UniProt ID | Q9Z0F5 |
mRNA ID | NM_009890 |
Length | 298 |
RefSeq Status | PROVISIONAL |
MGCYNGSELQDLGCSSQLLLQPLWDTIRTREAFTRSPIFPVTFSIITYVGFCLPFVVLDVLYPWVPILRRYKIHPDFSPSVKQLLPCLGLTLYQHLVFVFPVTLLHWVRSPALLPQEAPELVQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLTIFTFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0001567 | IEA:UniProtKB-EC | F | cholesterol 25-hydroxylase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0008395 | IDA:MGI | F | steroid hydroxylase activity |
GO:0008203 | IDA:MGI | P | cholesterol metabolic process |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00120 | Primary bile acid biosynthesis |
mmu00120 | Primary bile acid biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5893440 | Synthesis of bile acids and bile salts |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Cholesterol + AH(2) + O(2) = 25- hydroxycholesterol + A + H(2)O. {ECO:0000269|PubMed:9852097}. |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000269|PubMed:9852097}; |
Disruption Phenotype | Mice do not display any apparent alteration in bile acid synthesis and cholesterol metabolism. {ECO:0000269|PubMed:12543708}. |
Function | Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes. May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. In testis, production of 25- hydroxycholesterol by macrophages may play a role in Leydig cell differentiation. {ECO:0000269|PubMed:9852097}. |
Ptm | N-glycosylated. {ECO:0000269|PubMed:9852097}. |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:9852097}; Multi-pass membrane protein {ECO:0000269|PubMed:9852097}. |
Tissue Specificity | Widely expressed at low level and at higher level in the lung. Weakly expressed in the heart, lung and kidney. {ECO:0000269|PubMed:9852097}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006329 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6857769 | RefSeq | NP_034020 | 298 | cholesterol 25-hydroxylase |
Identical Sequences to LMP006329 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6857769 | DBBJ | BAE24352.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | DBBJ | BAE31482.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | EMBL | CAR81283.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | EMBL | CBX84761.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | GenBank | EDL41749.1 | 298 | cholesterol 25-hydroxylase [Mus musculus] |
GI:6857769 | SwissProt | Q9Z0F5.1 | 298 | RecName: Full=Cholesterol 25-hydroxylase; AltName: Full=Cholesterol 25-monooxygenase; Short=m25OH [Mus musculus] |
Related Sequences to LMP006329 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6857769 | DBBJ | BAE35945.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | EMBL | CAR81327.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | EMBL | CAR81339.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | EMBL | CBX84805.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | EMBL | CBX84815.1 | 298 | unnamed protein product [Mus musculus] |
GI:6857769 | GenBank | AAH39919.1 | 298 | Cholesterol 25-hydroxylase [Mus musculus] |