Gene/Proteome Database (LMPD)
LMPD ID
LMP006459
Gene ID
Species
Homo sapiens (Human)
Gene Name
serum/glucocorticoid regulated kinase family, member 3
Gene Symbol
Synonyms
CISK; SGK2; SGKL
Chromosome
8
Map Location
8q12
Summary
This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| serine/threonine-protein kinase Sgk3 isoform 1 | |
|---|---|
| Refseq ID | NP_037389 |
| Protein GI | 31563382 |
| UniProt ID | Q53EW6 |
| mRNA ID | NM_013257 |
| Length | 496 |
| RefSeq Status | REVIEWED |
| MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL | |
| serine/threonine-protein kinase Sgk3 isoform 1 | |
|---|---|
| Refseq ID | NP_001028750 |
| Protein GI | 75813626 |
| UniProt ID | Q5H9Q5 |
| mRNA ID | NM_001033578 |
| Length | 496 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:31563382 (mRNA isoform) | |
| serine/threonine-protein kinase Sgk3 isoform 2 | |
|---|---|
| Refseq ID | NP_733827 |
| Protein GI | 31563383 |
| UniProt ID | Q53EW6 |
| mRNA ID | NM_170709 |
| Length | 464 |
| RefSeq Status | REVIEWED |
| MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL | |
Gene Information
Entrez Gene ID
Gene Name
serum/glucocorticoid regulated kinase family, member 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0035091 | IEA:InterPro | F | phosphatidylinositol binding |
| GO:0004674 | IEA:UniProtKB-KW | F | protein serine/threonine kinase activity |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_160189 | Stimuli-sensing channels |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000961 | AGC-kinase, C-terminal |
| IPR001683 | Phox homologous domain |
| IPR000719 | Protein kinase domain |
| IPR017441 | Protein kinase, ATP binding site |
| IPR017892 | Protein kinase, C-terminal |
| IPR011009 | Protein kinase-like domain |
| IPR008271 | Serine/threonine-protein kinase, active site |
| IPR002290 | Serine/threonine/dual specificity protein kinase, catalytic domain |
UniProt Annotations
Entry Information
Gene Name
serum/glucocorticoid regulated kinase family, member 3
Protein Entry
SGK3_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + a protein = ADP + a phosphoprotein. |
| Similarity | Contains AGC-kinase C-terminal domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006459 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 31563382 | RefSeq | NP_037389 | 496 | serine/threonine-protein kinase Sgk3 isoform 1 |
| 31563383 | RefSeq | NP_733827 | 464 | serine/threonine-protein kinase Sgk3 isoform 2 |
Identical Sequences to LMP006459 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31563383 | DBBJ | BAG51984.1 | 464 | unnamed protein product [Homo sapiens] |
| GI:31563383 | EMBL | CAF86721.1 | 464 | unnamed protein product [Homo sapiens] |
| GI:31563382 | GenBank | AHD73908.1 | 496 | Sequence 12366 from patent US 8586006 |
| GI:31563382 | GenBank | AHD73909.1 | 496 | Sequence 12367 from patent US 8586006 |
| GI:31563383 | GenBank | AHD73910.1 | 464 | Sequence 12368 from patent US 8586006 |
| GI:31563382 | GenBank | AIC51022.1 | 496 | SGK3, partial [synthetic construct] |
| GI:31563382 | GenBank | AIC62717.1 | 496 | SGK3, partial [synthetic construct] |
| GI:31563383 | RefSeq | XP_003274840.1 | 464 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform 2 [Nomascus leucogenys] |
| GI:31563382 | RefSeq | XP_003831405.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Pan paniscus] |
| GI:31563382 | RefSeq | XP_008954969.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Pan paniscus] |
Related Sequences to LMP006459 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31563382 | EMBL | CAI45969.1 | 496 | hypothetical protein [Homo sapiens] |
| GI:31563383 | GenBank | AAH15326.1 | 496 | Serum/glucocorticoid regulated kinase family, member 3 [Homo sapiens] |
| GI:31563382 | GenBank | AAQ02420.1 | 497 | serum/glucocorticoid regulated kinase-like, partial [synthetic construct] |
| GI:31563383 | RefSeq | NP_037389.4 | 496 | serine/threonine-protein kinase Sgk3 isoform 1 [Homo sapiens] |
| GI:31563383 | RefSeq | NP_001028750.1 | 496 | serine/threonine-protein kinase Sgk3 isoform 1 [Homo sapiens] |
| GI:31563383 | RefSeq | NP_001127544.1 | 496 | serine/threonine-protein kinase Sgk3 [Pongo abelii] |
| GI:31563382 | RefSeq | XP_003902874.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Papio anubis] |
| GI:31563383 | RefSeq | XP_004588084.1 | 464 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X3 [Ochotona princeps] |
| GI:31563382 | RefSeq | XP_007998977.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Chlorocebus sabaeus] |
| GI:31563382 | RefSeq | XP_007998978.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Chlorocebus sabaeus] |
| GI:31563382 | RefSeq | XP_007998979.1 | 496 | PREDICTED: serine/threonine-protein kinase Sgk3 isoform X1 [Chlorocebus sabaeus] |
| GI:31563383 | SwissProt | Q5R7A7.1 | 496 | RecName: Full=Serine/threonine-protein kinase Sgk3; AltName: Full=Serum/glucocorticoid-regulated kinase 3 [Pongo abelii] |