Gene/Proteome Database (LMPD)
LMPD ID
LMP006525
Gene ID
Species
Mus musculus (Mouse)
Gene Name
fucosyltransferase 9
Gene Symbol
Synonyms
AI746471; AU067636; mFUT9; mFuc-TIX
Alternate Names
alpha-(1,3)-fucosyltransferase 9; fuc-TIX; fucT-IX; fucosyltransferase IX; galactoside 3-L-fucosyltransferase
Chromosome
4
Map Location
4 A3|4 10.59 cM
EC Number
2.4.1.-
Proteins
alpha-(1,3)-fucosyltransferase 9 | |
---|---|
Refseq ID | NP_034373 |
Protein GI | 6753922 |
UniProt ID | O88819 |
mRNA ID | NM_010243 |
Length | 359 |
RefSeq Status | VALIDATED |
MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0046920 | IDA:MGI | F | alpha-(1->3)-fucosyltransferase activity |
GO:0036065 | IDA:GOC | P | fucosylation |
GO:0007399 | IEA:Ensembl | P | nervous system development |
GO:0006486 | IDA:MGI | P | protein glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001503 | Glycosyl transferase, family 10 |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. {ECO:0000269|PubMed:9756916}. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 10 family. {ECO:0000305}. |
Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}. |
Tissue Specificity | Mainly detected in brain and kidney. {ECO:0000269|PubMed:9756916}. |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 9; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_616"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP006525 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6753922 | RefSeq | NP_034373 | 359 | alpha-(1,3)-fucosyltransferase 9 |
Identical Sequences to LMP006525 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6753922 | DBBJ | BAE37522.1 | 359 | unnamed protein product [Mus musculus] |
GI:6753922 | GenBank | AAI16877.1 | 359 | Fucosyltransferase 9 [Mus musculus] |
GI:6753922 | GenBank | AAI16875.1 | 359 | Fucosyltransferase 9 [Mus musculus] |
GI:6753922 | GenBank | EDL05524.1 | 359 | fucosyltransferase 9 [Mus musculus] |
GI:6753922 | GenBank | ABW46651.1 | 359 | Sequence 1 from patent US 7262039 |
GI:6753922 | GenBank | AFG79858.1 | 359 | Sequence 117 from patent US 8137928 |
Related Sequences to LMP006525 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6753922 | GenBank | ELW54527.1 | 359 | Alpha-(1,3)-fucosyltransferase [Tupaia chinensis] |
GI:6753922 | RefSeq | NP_006572.2 | 359 | alpha-(1,3)-fucosyltransferase 9 [Homo sapiens] |
GI:6753922 | RefSeq | XP_002746880.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Callithrix jacchus] |
GI:6753922 | RefSeq | XP_004044470.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase-like [Gorilla gorilla gorilla] |
GI:6753922 | RefSeq | XP_008004843.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |
GI:6753922 | RefSeq | XP_008004844.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |