Gene/Proteome Database (LMPD)
LMPD ID
LMP006525
Gene ID
Species
Mus musculus (Mouse)
Gene Name
fucosyltransferase 9
Gene Symbol
Synonyms
AI746471; AU067636; mFUT9; mFuc-TIX
Alternate Names
alpha-(1,3)-fucosyltransferase 9; fuc-TIX; fucT-IX; fucosyltransferase IX; galactoside 3-L-fucosyltransferase
Chromosome
4
Map Location
4 A3|4 10.59 cM
EC Number
2.4.1.-
Proteins
| alpha-(1,3)-fucosyltransferase 9 | |
|---|---|
| Refseq ID | NP_034373 |
| Protein GI | 6753922 |
| UniProt ID | O88819 |
| mRNA ID | NM_010243 |
| Length | 359 |
| RefSeq Status | VALIDATED |
| MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0046920 | IDA:MGI | F | alpha-(1->3)-fucosyltransferase activity |
| GO:0036065 | IDA:GOC | P | fucosylation |
| GO:0007399 | IEA:Ensembl | P | nervous system development |
| GO:0006486 | IDA:MGI | P | protein glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001503 | Glycosyl transferase, family 10 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. {ECO:0000269|PubMed:9756916}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 10 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}. |
| Tissue Specificity | Mainly detected in brain and kidney. {ECO:0000269|PubMed:9756916}. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 9; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_616"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP006525 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6753922 | RefSeq | NP_034373 | 359 | alpha-(1,3)-fucosyltransferase 9 |
Identical Sequences to LMP006525 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6753922 | DBBJ | BAE37522.1 | 359 | unnamed protein product [Mus musculus] |
| GI:6753922 | GenBank | AAI16877.1 | 359 | Fucosyltransferase 9 [Mus musculus] |
| GI:6753922 | GenBank | AAI16875.1 | 359 | Fucosyltransferase 9 [Mus musculus] |
| GI:6753922 | GenBank | EDL05524.1 | 359 | fucosyltransferase 9 [Mus musculus] |
| GI:6753922 | GenBank | ABW46651.1 | 359 | Sequence 1 from patent US 7262039 |
| GI:6753922 | GenBank | AFG79858.1 | 359 | Sequence 117 from patent US 8137928 |
Related Sequences to LMP006525 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6753922 | GenBank | ELW54527.1 | 359 | Alpha-(1,3)-fucosyltransferase [Tupaia chinensis] |
| GI:6753922 | RefSeq | NP_006572.2 | 359 | alpha-(1,3)-fucosyltransferase 9 [Homo sapiens] |
| GI:6753922 | RefSeq | XP_002746880.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Callithrix jacchus] |
| GI:6753922 | RefSeq | XP_004044470.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase-like [Gorilla gorilla gorilla] |
| GI:6753922 | RefSeq | XP_008004843.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |
| GI:6753922 | RefSeq | XP_008004844.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |