Gene/Proteome Database (LMPD)

LMPD ID
LMP006525
Gene ID
Species
Mus musculus (Mouse)
Gene Name
fucosyltransferase 9
Gene Symbol
Synonyms
AI746471; AU067636; mFUT9; mFuc-TIX
Alternate Names
alpha-(1,3)-fucosyltransferase 9; fuc-TIX; fucT-IX; fucosyltransferase IX; galactoside 3-L-fucosyltransferase
Chromosome
4
Map Location
4 A3|4 10.59 cM
EC Number
2.4.1.-

Proteins

alpha-(1,3)-fucosyltransferase 9
Refseq ID NP_034373
Protein GI 6753922
UniProt ID O88819
mRNA ID NM_010243
Length 359
RefSeq Status VALIDATED
MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN

Gene Information

Entrez Gene ID
Gene Name
fucosyltransferase 9
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0046920 IDA:MGI F alpha-(1->3)-fucosyltransferase activity
GO:0036065 IDA:GOC P fucosylation
GO:0007399 IEA:Ensembl P nervous system development
GO:0006486 IDA:MGI P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
mmu00603 Glycosphingolipid biosynthesis - globo series
mmu00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100 Metabolic pathways
mmu00514 Other types of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001503 Glycosyl transferase, family 10

UniProt Annotations

Entry Information

Gene Name
fucosyltransferase 9
Protein Entry
FUT9_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. {ECO:0000269|PubMed:9756916}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 10 family. {ECO:0000305}.
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}.
Tissue Specificity Mainly detected in brain and kidney. {ECO:0000269|PubMed:9756916}.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 9; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_616";

Identical and Related Proteins

Unique RefSeq proteins for LMP006525 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6753922 RefSeq NP_034373 359 alpha-(1,3)-fucosyltransferase 9

Identical Sequences to LMP006525 proteins

Reference Database Accession Length Protein Name
GI:6753922 DBBJ BAE37522.1 359 unnamed protein product [Mus musculus]
GI:6753922 GenBank AAI16877.1 359 Fucosyltransferase 9 [Mus musculus]
GI:6753922 GenBank AAI16875.1 359 Fucosyltransferase 9 [Mus musculus]
GI:6753922 GenBank EDL05524.1 359 fucosyltransferase 9 [Mus musculus]
GI:6753922 GenBank ABW46651.1 359 Sequence 1 from patent US 7262039
GI:6753922 GenBank AFG79858.1 359 Sequence 117 from patent US 8137928

Related Sequences to LMP006525 proteins

Reference Database Accession Length Protein Name
GI:6753922 GenBank ELW54527.1 359 Alpha-(1,3)-fucosyltransferase [Tupaia chinensis]
GI:6753922 RefSeq NP_006572.2 359 alpha-(1,3)-fucosyltransferase 9 [Homo sapiens]
GI:6753922 RefSeq XP_002746880.1 359 PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Callithrix jacchus]
GI:6753922 RefSeq XP_004044470.1 359 PREDICTED: alpha-(1,3)-fucosyltransferase-like [Gorilla gorilla gorilla]
GI:6753922 RefSeq XP_008004843.1 359 PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus]
GI:6753922 RefSeq XP_008004844.1 359 PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus]