Gene/Proteome Database (LMPD)
LMPD ID
LMP006553
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ELOVL family member 6, elongation of long chain fatty acids (yeast)
Gene Symbol
Synonyms
C77826; FAE; LCE
Alternate Names
elongation of very long chain fatty acids protein 6; ELOVL FA elongase 6; fatty acyl-CoA elongase; ELOVL fatty acid elongase 6; long chain fatty acid elongase; long chain fatty acyl elongase; myelin-associated SUR4 protein; 3-keto acyl-CoA synthase Elovl6; very-long-chain 3-oxoacyl-CoA synthase 6
Chromosome
3
Map Location
3 G3|3
EC Number
2.3.1.199
Proteins
| elongation of very long chain fatty acids protein 6 | |
|---|---|
| Refseq ID | NP_569717 |
| Protein GI | 18496985 |
| UniProt ID | Q920L5 |
| mRNA ID | NM_130450 |
| Length | 267 |
| RefSeq Status | PROVISIONAL |
| MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL family member 6, elongation of long chain fatty acids (yeast)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030176 | IDA:MGI | C | integral component of endoplasmic reticulum membrane |
| GO:0016747 | IDA:MGI | F | transferase activity, transferring acyl groups other than amino-acyl groups |
| GO:0030497 | IDA:MGI | P | fatty acid elongation |
| GO:0019367 | ISS:UniProtKB | P | fatty acid elongation, saturated fatty acid |
| GO:0042759 | ISS:UniProtKB | P | long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu01040 | Biosynthesis of unsaturated fatty acids |
| mmu00062 | Fatty acid elongation |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5894006 | Activation of gene expression by SREBF (SREBP) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
ELOVL family member 6, elongation of long chain fatty acids (yeast)
Protein Entry
ELOV6_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Function | Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. Elongates fatty acids with C12, 14 and 16 carbons. {ECO:0000269|PubMed:11567032, ECO:0000269|PubMed:12032166}. |
| Induction | By SREBF1. {ECO:0000269|PubMed:11567032, ECO:0000269|PubMed:12032166}. |
| Similarity | Belongs to the ELO family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Microsome membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Highly expressed in adrenal gland, liver, white adipose tissue (WAT), adult and fetal brain, cerebellum, spinal cord, testis, skin and peripheral nerve; where lipogenesis and steroidogenesis are active. Weakly expressed in kidney, heart, skeletal muscle, lung, and spleen. {ECO:0000269|PubMed:11567032, ECO:0000269|PubMed:12032166, ECO:0000269|PubMed:12084938}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006553 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18496985 | RefSeq | NP_569717 | 267 | elongation of very long chain fatty acids protein 6 |
Identical Sequences to LMP006553 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18496985 | DBBJ | BAE39469.1 | 267 | unnamed protein product [Mus musculus] |
| GI:18496985 | GenBank | AAI00577.1 | 267 | ELOVL family member 6, elongation of long chain fatty acids (yeast) [Mus musculus] |
| GI:18496985 | GenBank | EDL12240.1 | 267 | ELOVL family member 6, elongation of long chain fatty acids (yeast), isoform CRA_a [Mus musculus] |
| GI:18496985 | GenBank | EDL12241.1 | 267 | ELOVL family member 6, elongation of long chain fatty acids (yeast), isoform CRA_a [Mus musculus] |
| GI:18496985 | RefSeq | XP_006501137.1 | 267 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Mus musculus] |
| GI:18496985 | SwissProt | Q920L5.1 | 267 | RecName: Full=Elongation of very long chain fatty acids protein 6; AltName: Full=3-keto acyl-CoA synthase Elovl6; AltName: Full=ELOVL fatty acid elongase 6; Short=ELOVL FA elongase 6; AltName: Full=Fatty acyl-CoA elongase; AltName: Full=Long chain fatty acid elongase; AltName: Full=Myelin-associated SUR4 protein; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 6 [Mus musculus] |
Related Sequences to LMP006553 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18496985 | GenBank | ACM94131.1 | 267 | Sequence 48 from patent US 7465564 |
| GI:18496985 | GenBank | ACR90619.1 | 267 | Sequence 37 from patent US 7524658 |
| GI:18496985 | GenBank | ACW03025.1 | 267 | Sequence 84 from patent US 7550286 |
| GI:18496985 | GenBank | ACW64310.1 | 267 | Sequence 51 from patent US 7588931 |
| GI:18496985 | GenBank | AGU18482.1 | 267 | Sequence 64 from patent US 8518674 |
| GI:18496985 | RefSeq | XP_008759707.1 | 267 | PREDICTED: elongation of very long chain fatty acids protein 6 [Rattus norvegicus] |