Gene/Proteome Database (LMPD)
Proteins
| steroid hormone receptor ERR2 isoform 1 | |
|---|---|
| Refseq ID | NP_036064 |
| Protein GI | 226958365 |
| UniProt ID | Q8CCV5 |
| mRNA ID | NM_011934 |
| Length | 454 |
| RefSeq Status | VALIDATED |
| MDVSELCIPDPLGYHNQLLNRMSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKEEFMILKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV | |
| steroid hormone receptor ERR2 isoform 2 | |
|---|---|
| Refseq ID | NP_001152972 |
| Protein GI | 226958367 |
| UniProt ID | Q80VS1 |
| mRNA ID | NM_001159500 |
| Length | 438 |
| RefSeq Status | VALIDATED |
| MLLNRMSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKEEFMILKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV | |
Gene Information
Entrez Gene ID
Gene Name
estrogen related receptor, beta
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-SubCell | C | nucleus |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003700 | IEA:InterPro | F | sequence-specific DNA binding transcription factor activity |
| GO:0005496 | IEA:InterPro | F | steroid binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0001892 | IMP:MGI | P | embryonic placenta development |
| GO:0001701 | IMP:MGI | P | in utero embryonic development |
| GO:0019827 | IMP:MGI | P | stem cell maintenance |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
| GO:0001834 | IMP:MGI | P | trophectodermal cell proliferation |
| GO:0001831 | IMP:MGI | P | trophectodermal cellular morphogenesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008946 | Nuclear hormone receptor, ligand-binding |
| IPR000536 | Nuclear hormone receptor, ligand-binding, core |
| IPR024178 | Oestrogen receptor/oestrogen-related receptor |
| IPR027289 | Oestrogen-related receptor |
| IPR001723 | Steroid hormone receptor |
| IPR013088 | Zinc finger, NHR/GATA-type |
| IPR001628 | Zinc finger, nuclear hormone receptor-type |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Belongs to the nuclear hormone receptor family. |
| Similarity | Belongs to the nuclear hormone receptor family. NR3 subfamily. |
| Similarity | Contains nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus . |
Identical and Related Proteins
Unique RefSeq proteins for LMP006563 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 226958365 | RefSeq | NP_036064 | 454 | steroid hormone receptor ERR2 isoform 1 |
| 226958367 | RefSeq | NP_001152972 | 438 | steroid hormone receptor ERR2 isoform 2 |
Identical Sequences to LMP006563 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:226958365 | GenBank | EDL02902.1 | 454 | estrogen related receptor, beta, isoform CRA_b [Mus musculus] |
Related Sequences to LMP006563 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:226958367 | DBBJ | BAC34898.1 | 433 | unnamed protein product [Mus musculus] |
| GI:226958365 | GenBank | AAH44858.1 | 434 | Esrrb protein, partial [Mus musculus] |
| GI:226958367 | GenBank | AAH44858.1 | 434 | Esrrb protein, partial [Mus musculus] |
| GI:226958367 | GenBank | EDL02902.1 | 454 | estrogen related receptor, beta, isoform CRA_b [Mus musculus] |
| GI:226958365 | GenBank | EDL81605.1 | 454 | estrogen-related receptor beta [Rattus norvegicus] |
| GI:226958365 | GenBank | AAI32598.2 | 433 | Estrogen related receptor, beta [Mus musculus] |
| GI:226958367 | GenBank | AAI32598.2 | 433 | Estrogen related receptor, beta [Mus musculus] |
| GI:226958367 | RefSeq | NP_036064.3 | 454 | steroid hormone receptor ERR2 isoform 1 [Mus musculus] |
| GI:226958365 | RefSeq | NP_001152972.1 | 438 | steroid hormone receptor ERR2 isoform 2 [Mus musculus] |
| GI:226958365 | RefSeq | XP_006515944.1 | 440 | PREDICTED: steroid hormone receptor ERR2 isoform X1 [Mus musculus] |
| GI:226958367 | RefSeq | XP_006515944.1 | 440 | PREDICTED: steroid hormone receptor ERR2 isoform X1 [Mus musculus] |
| GI:226958365 | RefSeq | XP_008762981.1 | 454 | PREDICTED: steroid hormone receptor ERR2 isoform X3 [Rattus norvegicus] |