Gene/Proteome Database (LMPD)
Proteins
fatty acid desaturase 6 | |
---|---|
Refseq ID | NP_828874 |
Protein GI | 267844885 |
UniProt ID | Q80UG1 |
mRNA ID | NM_178035 |
Length | 342 |
RefSeq Status | VALIDATED |
METVRSAPPGDGAAEALLKELERQVQDVVRASSWWERHGVDCAILALSLLALPAGFLCLRAHNILAFATGITILGVCHYTLTVKGSHLATHSALTESKRWSKILMIFFLEVCTAFSAEFAKFNHVNLHHVYTNVVGLGDSSTWKVPLLNRYVYMFLGPLLVPIITPLVALEHLRKEEPRTALRTLGFICLGLYSQYWLFMNVSGFKNPSSALACMLLTRSLLAHPYLHVNIFQHIGLPMFSPDKKPRRIHMMTLGVLNLPRQLVLDWAFGHSLISCHVEHHLFPWLSDHMCLKVKPLVSKFLHEKQLPYNEDSYLARFQLFLSRYEEFMVHVPPITELVGVQ |
Gene Information
Entrez Gene ID
Gene Name
fatty acid desaturase domain family, member 6
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005804 | Fatty acid desaturase, type 1 |
UniProt Annotations
Entry Information
Gene Name
fatty acid desaturase domain family, member 6
Protein Entry
FADS6_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q80UG1-1; Sequence=Displayed; Name=2; IsoId=Q80UG1-2; Sequence=VSP_034321; Note=No experimental confirmation available.; |
Pathway | Lipid metabolism; fatty acid metabolism. |
Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006570 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
267844885 | RefSeq | NP_828874 | 342 | fatty acid desaturase 6 |
Identical Sequences to LMP006570 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:267844885 | DBBJ | BAC57425.1 | 342 | hypothetical protein [Mus musculus] |
GI:267844885 | GenBank | AAI32042.1 | 342 | Fatty acid desaturase domain family, member 6 [Mus musculus] |
GI:267844885 | GenBank | AAI32068.1 | 342 | Fatty acid desaturase domain family, member 6 [Mus musculus] |
GI:267844885 | SwissProt | Q80UG1.1 | 342 | RecName: Full=Fatty acid desaturase 6 [Mus musculus] |
Related Sequences to LMP006570 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:267844885 | DBBJ | BAC67683.1 | 342 | hypothetical protein containing four transmembrane-spanning domain [Mus musculus] |
GI:267844885 | GenBank | EDL34472.1 | 318 | fatty acid desaturase domain family, member 6, partial [Mus musculus] |
GI:267844885 | GenBank | EDM06570.1 | 342 | fatty acid desaturase domain family, member 6 (predicted) [Rattus norvegicus] |
GI:267844885 | GenBank | EGV92372.1 | 342 | Fatty acid desaturase 6 [Cricetulus griseus] |
GI:267844885 | RefSeq | NP_001100534.1 | 342 | fatty acid desaturase 6 [Rattus norvegicus] |
GI:267844885 | RefSeq | XP_003495717.1 | 342 | PREDICTED: fatty acid desaturase 6 [Cricetulus griseus] |