Gene/Proteome Database (LMPD)
Proteins
| fatty acid desaturase 6 | |
|---|---|
| Refseq ID | NP_828874 |
| Protein GI | 267844885 |
| UniProt ID | Q80UG1 |
| mRNA ID | NM_178035 |
| Length | 342 |
| RefSeq Status | VALIDATED |
| METVRSAPPGDGAAEALLKELERQVQDVVRASSWWERHGVDCAILALSLLALPAGFLCLRAHNILAFATGITILGVCHYTLTVKGSHLATHSALTESKRWSKILMIFFLEVCTAFSAEFAKFNHVNLHHVYTNVVGLGDSSTWKVPLLNRYVYMFLGPLLVPIITPLVALEHLRKEEPRTALRTLGFICLGLYSQYWLFMNVSGFKNPSSALACMLLTRSLLAHPYLHVNIFQHIGLPMFSPDKKPRRIHMMTLGVLNLPRQLVLDWAFGHSLISCHVEHHLFPWLSDHMCLKVKPLVSKFLHEKQLPYNEDSYLARFQLFLSRYEEFMVHVPPITELVGVQ | |
Gene Information
Entrez Gene ID
Gene Name
fatty acid desaturase domain family, member 6
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005804 | Fatty acid desaturase, type 1 |
UniProt Annotations
Entry Information
Gene Name
fatty acid desaturase domain family, member 6
Protein Entry
FADS6_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q80UG1-1; Sequence=Displayed; Name=2; IsoId=Q80UG1-2; Sequence=VSP_034321; Note=No experimental confirmation available.; |
| Pathway | Lipid metabolism; fatty acid metabolism. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006570 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 267844885 | RefSeq | NP_828874 | 342 | fatty acid desaturase 6 |
Identical Sequences to LMP006570 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:267844885 | DBBJ | BAC57425.1 | 342 | hypothetical protein [Mus musculus] |
| GI:267844885 | GenBank | AAI32042.1 | 342 | Fatty acid desaturase domain family, member 6 [Mus musculus] |
| GI:267844885 | GenBank | AAI32068.1 | 342 | Fatty acid desaturase domain family, member 6 [Mus musculus] |
| GI:267844885 | SwissProt | Q80UG1.1 | 342 | RecName: Full=Fatty acid desaturase 6 [Mus musculus] |
Related Sequences to LMP006570 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:267844885 | DBBJ | BAC67683.1 | 342 | hypothetical protein containing four transmembrane-spanning domain [Mus musculus] |
| GI:267844885 | GenBank | EDL34472.1 | 318 | fatty acid desaturase domain family, member 6, partial [Mus musculus] |
| GI:267844885 | GenBank | EDM06570.1 | 342 | fatty acid desaturase domain family, member 6 (predicted) [Rattus norvegicus] |
| GI:267844885 | GenBank | EGV92372.1 | 342 | Fatty acid desaturase 6 [Cricetulus griseus] |
| GI:267844885 | RefSeq | NP_001100534.1 | 342 | fatty acid desaturase 6 [Rattus norvegicus] |
| GI:267844885 | RefSeq | XP_003495717.1 | 342 | PREDICTED: fatty acid desaturase 6 [Cricetulus griseus] |