Gene/Proteome Database (LMPD)
LMPD ID
LMP006579
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Gene Symbol
Synonyms
BC069960
Alternate Names
hexosaminidase D; beta-hexosaminidase D; beta-N-acetylhexosaminidase; N-acetyl-beta-galactosaminidase; hexosaminidase domain-containing protein
Chromosome
11
Map Location
11 E2|11
EC Number
3.2.1.52
Proteins
hexosaminidase D isoform 1 | |
---|---|
Refseq ID | NP_001139545 |
Protein GI | 225703123 |
UniProt ID | Q3U4H6 |
mRNA ID | NM_001146073 |
Length | 559 |
RefSeq Status | VALIDATED |
MSSPTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRAKHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVALFPNTLNPHEAESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNSHAKLCLSHMQAVASHVLTQHPGVTPLVWDDMLRDIPQEQLKASGVPQLVEPVLWDYGADLDVHGKVFLIGKYQECGFQRLWAASAFKGATGASQALPPVEHHIRNHELWLQVAGSGPKDALQGIILTGWQRYDHFSVLCELLPVGIPSLAACLQSLVHGALDYSASEPGHLYMDCVVRPGAPADCAATTFHMFTGKQPPGLAGAPQDAVPFAHSTQRSGVLSEHFCLWTVSGGFAEDVRLRAERFLGVSSLEIADTVSEGAGSFPGSDIHALVTQISLHLRSSVDTLLERNRYVTGWFSPYHRRRKLVHPVMIQHIQPEALSLLSRWNNLVQQLEVALQPVFYPDTIEEWLEENVLPSLQRLQDLLQDLGEAAARQPPPTSPGWDTGQNP |
hexosaminidase D isoform 2 | |
---|---|
Refseq ID | NP_001001333 |
Protein GI | 225703121 |
UniProt ID | Q3U4H6 |
mRNA ID | NM_001001333 |
Length | 486 |
RefSeq Status | VALIDATED |
MSSPTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRAKHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVALFPNTLNPHEAESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNSHAKLCLSHMQAVASHVLTQHPGVTPLVWDDMLRDIPQEQLKASGVPQLVEPVLWDYGADLDVHGKVFLIGKYQECGFQRLWAASAFKGATGASQALPPVEHHIRNHELWLQVAGSGPKDALQGIILTGWQRYDHFSVLCELLPVGIPSLAACLQSLVHGGFAEDVRLRAERFLGVSSLEIADTVSEGAGSFPGSDIHALVTQISLHLRSSVDTLLERNRYVTGWFSPYHRRRKLVHPVMIQHIQPEALSLLSRWNNLVQQLEVALQPVFYPDTIEEWLEENVLPSLQRLQDLLQDLGEAAARQPPPTSPGWDTGQNP |
Gene Information
Entrez Gene ID
Gene Name
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0004563 | IEA:UniProtKB-EC | F | beta-N-acetylhexosaminidase activity |
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Protein Entry
HEXDC_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q3U4H6-1; Sequence=Displayed; Name=2; IsoId=Q3U4H6-2; Sequence=VSP_030778; Note=No experimental confirmation available.; |
Biophysicochemical Properties | Kinetic parameters: KM=0.25 mM for p-nitrophenyl-beta-N-acetylgalactosaminide {ECO:0000269|PubMed:19040401}; pH dependence: Optimum pH is 5.5. {ECO:0000269|PubMed:19040401}; Temperature dependence: Optimum temperature is 37 degrees Celsius. {ECO:0000269|PubMed:19040401}; |
Catalytic Activity | Hydrolysis of terminal non-reducing N-acetyl- D-hexosamine residues in N-acetyl-beta-D-hexosaminides. {ECO:0000269|PubMed:19040401}. |
Enzyme Regulation | Inhibited by O-(2-acetamido-2-deoxy-D- glucopyranosylidene)amino N-phenylcarbamate (PUGNAc). {ECO:0000269|PubMed:19040401}. |
Function | Has hexosaminidase activity. {ECO:0000269|PubMed:19040401}. |
Sequence Caution | Sequence=AAH69960.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Belongs to the glycosyl hydrolase 20 family. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000269|PubMed:19040401}. Nucleus {ECO:0000269|PubMed:19040401}. |
Subunit | Homodimer; disulfide-linked. {ECO:0000269|PubMed:19040401}. |
Tissue Specificity | Ubiquitous. {ECO:0000269|PubMed:19040401}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006579 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
225703123 | RefSeq | NP_001139545 | 559 | hexosaminidase D isoform 1 |
225703121 | RefSeq | NP_001001333 | 486 | hexosaminidase D isoform 2 |
Identical Sequences to LMP006579 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:225703121 | DBBJ | BAE32455.1 | 486 | unnamed protein product [Mus musculus] |
GI:225703121 | EMBL | CAR57923.1 | 486 | hexosaminidase D [Mus musculus] |
GI:225703123 | RefSeq | XP_006533327.1 | 559 | PREDICTED: hexosaminidase D isoform X5 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533328.1 | 559 | PREDICTED: hexosaminidase D isoform X6 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533329.1 | 559 | PREDICTED: hexosaminidase D isoform X7 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533330.1 | 559 | PREDICTED: hexosaminidase D isoform X8 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533331.1 | 559 | PREDICTED: hexosaminidase D isoform X9 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533332.1 | 559 | PREDICTED: hexosaminidase D isoform X10 [Mus musculus] |
GI:225703121 | SwissProt | Q3U4H6.1 | 486 | RecName: Full=Hexosaminidase D; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=Beta-hexosaminidase D; AltName: Full=Hexosaminidase domain-containing protein; AltName: Full=N-acetyl-beta-galactosaminidase [Mus musculus] |
Related Sequences to LMP006579 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:225703123 | GenBank | AAH69960.1 | 467 | Hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing [Mus musculus] |
GI:225703121 | RefSeq | NP_001136034.2 | 486 | hexosaminidase D [Rattus norvegicus] |
GI:225703121 | RefSeq | XP_005069836.1 | 486 | PREDICTED: hexosaminidase D [Mesocricetus auratus] |
GI:225703121 | RefSeq | XP_006247922.1 | 486 | PREDICTED: hexosaminidase D isoform X1 [Rattus norvegicus] |
GI:225703123 | RefSeq | XP_006533323.1 | 608 | PREDICTED: hexosaminidase D isoform X1 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533324.1 | 582 | PREDICTED: hexosaminidase D isoform X2 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533325.1 | 578 | PREDICTED: hexosaminidase D isoform X3 [Mus musculus] |
GI:225703123 | RefSeq | XP_006533326.1 | 574 | PREDICTED: hexosaminidase D isoform X4 [Mus musculus] |
GI:225703121 | RefSeq | XP_006533333.1 | 535 | PREDICTED: hexosaminidase D isoform X11 [Mus musculus] |
GI:225703123 | RefSeq | XP_006912406.1 | 545 | PREDICTED: hexosaminidase D [Pteropus alecto] |
GI:225703121 | RefSeq | XP_006987695.1 | 486 | PREDICTED: hexosaminidase D isoform X1 [Peromyscus maniculatus bairdii] |
GI:225703121 | RefSeq | XP_008766721.1 | 486 | PREDICTED: hexosaminidase D isoform X1 [Rattus norvegicus] |