Gene/Proteome Database (LMPD)
LMPD ID
LMP006601
Gene ID
Species
Mus musculus (Mouse)
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Gene Symbol
Synonyms
beta3GnT5
Alternate Names
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase; BGnT-5; beta3Gn-T5; lc3 synthase; beta-1,3-Gn-T5; lc(3)Cer synthase; lactotriaosylceramide synthase; beta-1,3-N-acetylglucosaminyltransferase 5; UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5
Chromosome
16
Map Location
16|16 B1
EC Number
2.4.1.206
Proteins
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase | |
---|---|
Refseq ID | NP_001152879 |
Protein GI | 226874881 |
UniProt ID | Q8BGY6 |
mRNA ID | NM_001159407 |
Length | 376 |
RefSeq Status | VALIDATED |
MRLFVSRRVKRWKIFHFFVTCFILSFMVFWSPINNYIMSHMKSYSYRYLVNSYGFVNNSLSLKHSSVQPHYPYLINHREKCQAQDVLLLLFIKTAPENYGRRSAIRKTWGNENYVQSQLNANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDSFHNLTSKFLLQFSWANTFCPHAKFLMTADDDIFIHMPNLIEYLQGLEQIGVRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYEASQTLNSSMYIDDVFMGLCANKVGILPQDHVFFSGEGKIPYHPCIYEKMMTSHGHLQDLQDLWIEATHPKVKNISKGFFGQIYCRLIKIVLLCRLTYRNSYPCWAAFA |
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase | |
---|---|
Refseq ID | NP_473393 |
Protein GI | 31542177 |
UniProt ID | Q8BGY6 |
mRNA ID | NM_054052 |
Length | 376 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:226874881 (mRNA isoform) |
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase | |
---|---|
Refseq ID | NP_001152880 |
Protein GI | 226874883 |
UniProt ID | Q8BGY6 |
mRNA ID | NM_001159408 |
Length | 376 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:226874881 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005622 | ISS:UniProtKB | C | intracellular |
GO:0008457 | ISS:UniProtKB | F | beta-galactosyl-N-acetylglucosaminylgalactosylglucosyl-ceramide beta-1,3-acetylglucosaminyltransferase activity |
GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
GO:0047256 | IEA:UniProtKB-EC | F | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase activity |
GO:0008917 | IDA:MGI | F | lipopolysaccharide N-acetylglucosaminyltransferase activity |
GO:0007417 | ISS:UniProtKB | P | central nervous system development |
GO:0009103 | IDA:GOC | P | lipopolysaccharide biosynthetic process |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
GO:0030148 | TAS:MGI | P | sphingolipid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Protein Entry
B3GN5_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | UDP-N-acetyl-D-glucosamine + beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide = UDP + N- acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D- glucosyl-(1<->1)-ceramide. {ECO:0000269|PubMed:11384981}. |
Developmental Stage | Mainly expressed during embryonic development. Expressed in most tissues at embryonic day 11 with elevated expression in the developing central nervous system. {ECO:0000269|PubMed:11384981}. |
Function | Beta-1,3-N-acetylglucosaminyltransferase that plays a key role in the synthesis of lacto- or neolacto-series carbohydrate chains on glycolipids, notably by participating in biosynthesis of HNK-1 and Lewis X carbohydrate structures. Has strong activity toward lactosylceramide (LacCer) and neolactotetraosylceramide (nLc(4)Cer; paragloboside), resulting in the synthesis of Lc(3)Cer and neolactopentaosylceramide (nLc(5)Cer), respectively. Plays a central role in regulating neolacto-series glycolipid synthesis during embryonic development. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 31 family. {ECO:0000305}. |
Subcellular Location | Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. |
Tissue Specificity | Highly expressed in adult spleen, placenta and cerebellar Purkinje cells where it colocalized with HNK-1. Expressed at lower level in brain, lung, thymus and muscle. {ECO:0000269|PubMed:11384981}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006601 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
226874881 | RefSeq | NP_001152879 | 376 | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase |
Identical Sequences to LMP006601 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226874881 | GenBank | AAH63076.1 | 376 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Mus musculus] |
GI:226874881 | GenBank | EDK97556.1 | 376 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Mus musculus] |
GI:226874881 | RefSeq | NP_001152880.1 | 376 | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase [Mus musculus] |
GI:226874881 | RefSeq | XP_006521769.1 | 376 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase isoform X1 [Mus musculus] |
GI:226874881 | RefSeq | XP_006521770.1 | 376 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase isoform X2 [Mus musculus] |
GI:226874881 | SwissProt | Q8BGY6.1 | 376 | RecName: Full=Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase; AltName: Full=Lactotriaosylceramide synthase; Short=Lc(3)Cer synthase; Short=Lc3 synthase; AltName: Full=UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5; Short=BGnT-5; Short=Beta-1,3-Gn-T5; Short=Beta-1,3-N-acetylglucosaminyltransferase 5; Short=Beta3Gn-T5 [Mus musculus] |
Related Sequences to LMP006601 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226874881 | DBBJ | BAC66698.1 | 376 | beta1,3-N-acetylglucosaminyltransferase [Mus musculus] |
GI:226874881 | GenBank | AAK31579.1 | 376 | beta1,3 N-acetyglucosaminyltransferase Lc3 synthase [Mus musculus] |
GI:226874881 | GenBank | EDL77982.1 | 377 | rCG36757 [Rattus norvegicus] |
GI:226874881 | RefSeq | NP_446384.1 | 377 | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase [Rattus norvegicus] |
GI:226874881 | RefSeq | XP_008767071.1 | 377 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase isoform X1 [Rattus norvegicus] |
GI:226874881 | SwissProt | Q99NB2.2 | 377 | RecName: Full=Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase; AltName: Full=Lactotriaosylceramide synthase; Short=Lc(3)Cer synthase; Short=Lc3 synthase; AltName: Full=UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5; Short=BGnT-5; Short=Beta-1,3-Gn-T5; Short=Beta-1,3-N-acetylglucosaminyltransferase 5; Short=Beta3Gn-T5 [Rattus norvegicus] |