Gene/Proteome Database (LMPD)
Proteins
| otoconin-90 precursor | |
|---|---|
| Refseq ID | NP_001073868 |
| Protein GI | 223029412 |
| UniProt ID | Q02509 |
| mRNA ID | NM_001080399 |
| Length | 477 |
| RefSeq Status | VALIDATED |
| MIAFLLTSVLMIPHAGGHPLDTPHLPQELPPGLPNNINITFFSGMFKNVESVAEIFDCLGPHFTWLQAVFTNFPVLIQFVNGMKCVAGLCPRDFEDYGCTCRFEMEGLPVDESDSCCFQHRRCYEEAAEMDCLQDPAKLSTEVNCVSKKIICESKDNCEHLLCTCDKAAIECLARSSLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRVVPVEPTDTSLTALSGEEAGHDQEGVGAARATSPPGSAEIVATRVTAKIVTLVPAGIKSLGLAVSSVENDPEETTEKACDRFTFLHLGSGDNMQVMPQLGEMLFCLTSRCPEEFESYGCYCGQEGRGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKCGGQSLCEKLLCACDQTAAECMTSASFNQSLKSPSRLGCPGQPAACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLGRAKRFLRKSLGPLGIGPLHGR | |
| sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1771 peptide sequence: MIAFLLTSVLMIPHAGG | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | IEA:InterPro | F | phospholipase A2 activity |
| GO:0016042 | IEA:InterPro | P | lipid catabolic process |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q02509-1; Sequence=Displayed; Name=2; IsoId=Q02509-2; Sequence=VSP_040320; |
| Domain | Consists of 3 PA2-type domains. |
| Function | It is unlikely that this protein has phospholipase A2 activity. |
| Sequence Caution | Sequence=CAA78662.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted . |
| Subunit | Interacts with OTOL1. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006614 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 223029412 | RefSeq | NP_001073868 | 477 | otoconin-90 precursor |
Identical Sequences to LMP006614 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006614 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:223029412 | DBBJ | BAG60230.1 | 477 | unnamed protein product [Homo sapiens] |
| GI:223029412 | EMBL | CAA78662.1 | 689 | unnamed protein product [Human endogenous retrovirus] |
| GI:223029412 | GenBank | EAW92140.1 | 689 | HERV-H LTR-associating 1, isoform CRA_b [Homo sapiens] |
| GI:223029412 | RefSeq | XP_003830144.1 | 477 | PREDICTED: otoconin-90 [Pan paniscus] |
| GI:223029412 | RefSeq | XP_004047585.1 | 477 | PREDICTED: otoconin-90 [Gorilla gorilla gorilla] |
| GI:223029412 | SwissProt | Q02509.3 | 493 | RecName: Full=Otoconin-90; Short=Oc90; AltName: Full=Phospholipase A2 homolog; Flags: Precursor [Homo sapiens] |