Gene/Proteome Database (LMPD)

LMPD ID
LMP006615
Gene ID
Species
Homo sapiens (Human)
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Synonyms
UDPGT2B10
Alternate Names
UDP-glucuronosyltransferase 2B10; UDPGT 2B10
Chromosome
4
Map Location
4q13.2
EC Number
2.4.1.17

Proteins

UDP-glucuronosyltransferase 2B10 isoform 1 precursor
Refseq ID NP_001066
Protein GI 4507817
UniProt ID P36537
mRNA ID NM_001075
Length 528
RefSeq Status VALIDATED
MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD
UDP-glucuronosyltransferase 2B10 isoform 2 precursor
Refseq ID NP_001138239
Protein GI 221219059
UniProt ID P36537
mRNA ID NM_001144767
Length 444
RefSeq Status VALIDATED
MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD
UDP-glucuronosyltransferase 2B10 isoform 3
Refseq ID NP_001277020
Protein GI 587651900
UniProt ID P36537
mRNA ID NM_001290091
Length 280
RefSeq Status VALIDATED
MRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MALKWTTVLLIQLSFYFSSGSC sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MALKWTTVLLIQLSFYFSSGSC

Gene Information

Entrez Gene ID
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0015020 IEA:UniProtKB-EC F glucuronosyltransferase activity
GO:0006629 TAS:ProtInc P lipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05204 Chemical carcinogenesis
hsa00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase

UniProt Annotations

Entry Information

Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Protein Entry
UDB10_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P36537-1; Sequence=Displayed; Name=2; IsoId=P36537-2; Sequence=VSP_054337; Note=No experimental confirmation available.;
Catalytic Activity UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside.
Function UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Similarity Belongs to the UDP-glycosyltransferase family.
Subcellular Location Microsome membrane ; Single- pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP006615 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4507817 RefSeq NP_001066 528 UDP-glucuronosyltransferase 2B10 isoform 1 precursor
221219059 RefSeq NP_001138239 444 UDP-glucuronosyltransferase 2B10 isoform 2 precursor
587651900 RefSeq NP_001277020 280 UDP-glucuronosyltransferase 2B10 isoform 3

Identical Sequences to LMP006615 proteins

Reference Database Accession Length Protein Name
GI:4507817 DBBJ BAF85427.1 528 unnamed protein product [Homo sapiens]
GI:221219059 DBBJ BAG60653.1 444 unnamed protein product [Homo sapiens]
GI:4507817 GenBank AAI13650.1 528 UDP glucuronosyltransferase 2 family, polypeptide B10 [Homo sapiens]
GI:587651900 GenBank EAX05576.1 280 UDP glucuronosyltransferase 2 family, polypeptide B10, isoform CRA_a [Homo sapiens]
GI:4507817 GenBank EAX05577.1 528 UDP glucuronosyltransferase 2 family, polypeptide B10, isoform CRA_b [Homo sapiens]
GI:4507817 GenBank AHD75017.1 528 Sequence 15721 from patent US 8586006
GI:4507817 GenBank AIC49944.1 528 UGT2B10, partial [synthetic construct]
GI:4507817 SwissProt P36537.1 528 RecName: Full=UDP-glucuronosyltransferase 2B10; Short=UDPGT 2B10; Flags: Precursor [Homo sapiens]

Related Sequences to LMP006615 proteins

Reference Database Accession Length Protein Name
GI:4507817 DBBJ BAD96559.1 528 UDP glycosyltransferase 2 family, polypeptide B10 variant, partial [Homo sapiens]
GI:4507817 DBBJ BAD96592.1 528 UDP glycosyltransferase 2 family, polypeptide B10 variant, partial [Homo sapiens]
GI:587651900 DBBJ BAF85427.1 528 unnamed protein product [Homo sapiens]
GI:587651900 EMBL CAA44961.1 528 UDP-glucuronosyltransferase [Homo sapiens]
GI:221219059 GenBank AAM58916.1 454 Sequence 2 from patent US 6383789
GI:221219059 GenBank AAT23857.1 454 Sequence 2 from patent US 6713295
GI:587651900 GenBank AAI13650.1 528 UDP glucuronosyltransferase 2 family, polypeptide B10 [Homo sapiens]
GI:587651900 GenBank AHD75017.1 528 Sequence 15721 from patent US 8586006
GI:587651900 GenBank AIC49944.1 528 UGT2B10, partial [synthetic construct]
GI:4507817 RefSeq XP_001163060.1 528 PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X1 [Pan troglodytes]
GI:4507817 RefSeq XP_002814847.1 529 PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X1 [Pongo abelii]
GI:221219059 RefSeq XP_003265728.1 445 PREDICTED: UDP-glucuronosyltransferase 2B10 isoform 2 [Nomascus leucogenys]
GI:221219059 RefSeq XP_003265733.1 445 PREDICTED: UDP-glucuronosyltransferase 2B28 isoform 2 [Nomascus leucogenys]
GI:4507817 RefSeq XP_003310409.1 529 PREDICTED: UDP-glucuronosyltransferase 2B11 [Pan troglodytes]
GI:4507817 RefSeq XP_001162541.2 529 PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X1 [Pan troglodytes]
GI:221219059 RefSeq XP_003805579.1 445 PREDICTED: UDP-glucuronosyltransferase 2B11-like isoform X2 [Pan paniscus]
GI:221219059 RefSeq XP_009238311.1 445 PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X2 [Pongo abelii]
GI:587651900 SwissProt P36537.1 528 RecName: Full=UDP-glucuronosyltransferase 2B10; Short=UDPGT 2B10; Flags: Precursor [Homo sapiens]