Gene/Proteome Database (LMPD)
Proteins
| UDP-glucuronosyltransferase 2B10 isoform 1 precursor | |
|---|---|
| Refseq ID | NP_001066 |
| Protein GI | 4507817 |
| UniProt ID | P36537 |
| mRNA ID | NM_001075 |
| Length | 528 |
| RefSeq Status | VALIDATED |
| MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD | |
| UDP-glucuronosyltransferase 2B10 isoform 2 precursor | |
|---|---|
| Refseq ID | NP_001138239 |
| Protein GI | 221219059 |
| UniProt ID | P36537 |
| mRNA ID | NM_001144767 |
| Length | 444 |
| RefSeq Status | VALIDATED |
| MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD | |
| UDP-glucuronosyltransferase 2B10 isoform 3 | |
|---|---|
| Refseq ID | NP_001277020 |
| Protein GI | 587651900 |
| UniProt ID | P36537 |
| mRNA ID | NM_001290091 |
| Length | 280 |
| RefSeq Status | VALIDATED |
| MRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MALKWTTVLLIQLSFYFSSGSC sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MALKWTTVLLIQLSFYFSSGSC | |
Gene Information
Entrez Gene ID
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0015020 | IEA:UniProtKB-EC | F | glucuronosyltransferase activity |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002213 | UDP-glucuronosyl/UDP-glucosyltransferase |
UniProt Annotations
Entry Information
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Protein Entry
UDB10_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P36537-1; Sequence=Displayed; Name=2; IsoId=P36537-2; Sequence=VSP_054337; Note=No experimental confirmation available.; |
| Catalytic Activity | UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside. |
| Function | UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. |
| Similarity | Belongs to the UDP-glycosyltransferase family. |
| Subcellular Location | Microsome membrane ; Single- pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP006615 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4507817 | RefSeq | NP_001066 | 528 | UDP-glucuronosyltransferase 2B10 isoform 1 precursor |
| 221219059 | RefSeq | NP_001138239 | 444 | UDP-glucuronosyltransferase 2B10 isoform 2 precursor |
| 587651900 | RefSeq | NP_001277020 | 280 | UDP-glucuronosyltransferase 2B10 isoform 3 |
Identical Sequences to LMP006615 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4507817 | DBBJ | BAF85427.1 | 528 | unnamed protein product [Homo sapiens] |
| GI:221219059 | DBBJ | BAG60653.1 | 444 | unnamed protein product [Homo sapiens] |
| GI:4507817 | GenBank | AAI13650.1 | 528 | UDP glucuronosyltransferase 2 family, polypeptide B10 [Homo sapiens] |
| GI:587651900 | GenBank | EAX05576.1 | 280 | UDP glucuronosyltransferase 2 family, polypeptide B10, isoform CRA_a [Homo sapiens] |
| GI:4507817 | GenBank | EAX05577.1 | 528 | UDP glucuronosyltransferase 2 family, polypeptide B10, isoform CRA_b [Homo sapiens] |
| GI:4507817 | GenBank | AHD75017.1 | 528 | Sequence 15721 from patent US 8586006 |
| GI:4507817 | GenBank | AIC49944.1 | 528 | UGT2B10, partial [synthetic construct] |
| GI:4507817 | SwissProt | P36537.1 | 528 | RecName: Full=UDP-glucuronosyltransferase 2B10; Short=UDPGT 2B10; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP006615 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4507817 | DBBJ | BAD96559.1 | 528 | UDP glycosyltransferase 2 family, polypeptide B10 variant, partial [Homo sapiens] |
| GI:4507817 | DBBJ | BAD96592.1 | 528 | UDP glycosyltransferase 2 family, polypeptide B10 variant, partial [Homo sapiens] |
| GI:587651900 | DBBJ | BAF85427.1 | 528 | unnamed protein product [Homo sapiens] |
| GI:587651900 | EMBL | CAA44961.1 | 528 | UDP-glucuronosyltransferase [Homo sapiens] |
| GI:221219059 | GenBank | AAM58916.1 | 454 | Sequence 2 from patent US 6383789 |
| GI:221219059 | GenBank | AAT23857.1 | 454 | Sequence 2 from patent US 6713295 |
| GI:587651900 | GenBank | AAI13650.1 | 528 | UDP glucuronosyltransferase 2 family, polypeptide B10 [Homo sapiens] |
| GI:587651900 | GenBank | AHD75017.1 | 528 | Sequence 15721 from patent US 8586006 |
| GI:587651900 | GenBank | AIC49944.1 | 528 | UGT2B10, partial [synthetic construct] |
| GI:4507817 | RefSeq | XP_001163060.1 | 528 | PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X1 [Pan troglodytes] |
| GI:4507817 | RefSeq | XP_002814847.1 | 529 | PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X1 [Pongo abelii] |
| GI:221219059 | RefSeq | XP_003265728.1 | 445 | PREDICTED: UDP-glucuronosyltransferase 2B10 isoform 2 [Nomascus leucogenys] |
| GI:221219059 | RefSeq | XP_003265733.1 | 445 | PREDICTED: UDP-glucuronosyltransferase 2B28 isoform 2 [Nomascus leucogenys] |
| GI:4507817 | RefSeq | XP_003310409.1 | 529 | PREDICTED: UDP-glucuronosyltransferase 2B11 [Pan troglodytes] |
| GI:4507817 | RefSeq | XP_001162541.2 | 529 | PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X1 [Pan troglodytes] |
| GI:221219059 | RefSeq | XP_003805579.1 | 445 | PREDICTED: UDP-glucuronosyltransferase 2B11-like isoform X2 [Pan paniscus] |
| GI:221219059 | RefSeq | XP_009238311.1 | 445 | PREDICTED: UDP-glucuronosyltransferase 2B10 isoform X2 [Pongo abelii] |
| GI:587651900 | SwissProt | P36537.1 | 528 | RecName: Full=UDP-glucuronosyltransferase 2B10; Short=UDPGT 2B10; Flags: Precursor [Homo sapiens] |