Gene/Proteome Database (LMPD)
LMPD ID
LMP006664
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Gene Symbol
Synonyms
HSE; RODH; SDR9C6
Alternate Names
17-beta-hydroxysteroid dehydrogenase type 6; 17-beta-HSD 6; oxidoreductase; 3-alpha->beta-HSE; retinol dehydrogenase; 3-hydroxysteroid epimerase; 3-alpha->beta-hydroxysteroid epimerase; 3(alpha->beta)-hydroxysteroid epimerase; 3(alpha->beta)-hydroxysteroid epimerasel; oxidative 3-alpha hydroxysteroid dehydrogenase; oxidative 3-alpha-hydroxysteroid-dehydrogenase; hydroxysteroid (17-beta) dehydrogenase 6 homolog; short chain dehydrogenase/reductase family 9C, member 6; NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
Chromosome
12
Map Location
12q13
EC Number
1.1.1.105
Summary
The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. [provided by RefSeq, Aug 2013]
Orthologs
Proteins
| 17-beta-hydroxysteroid dehydrogenase type 6 precursor | |
|---|---|
| Refseq ID | NP_003716 |
| Protein GI | 19743808 |
| UniProt ID | O14756 |
| mRNA ID | NM_003725 |
| Length | 317 |
| RefSeq Status | REVIEWED |
| MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV | |
| sig_peptide: 1..17 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (O14756.1) calculated_mol_wt: 2160 peptide sequence: MWLYLAAFVGLYYLLHW mat_peptide: 18..317 product: 17-beta-hydroxysteroid dehydrogenase type 6 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O14756.1) calculated_mol_wt: 33824 peptide sequence: YRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0005768 | IEA:UniProtKB-KW | C | endosome |
| GO:0005622 | NAS:UniProtKB | C | intracellular |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0003824 | TAS:ProtInc | F | catalytic activity |
| GO:0009055 | TAS:UniProtKB | F | electron carrier activity |
| GO:0004303 | IEA:UniProtKB-EC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0016491 | NAS:UniProtKB | F | oxidoreductase activity |
| GO:0004745 | IEA:UniProtKB-EC | F | retinol dehydrogenase activity |
| GO:0047035 | IEA:UniProtKB-EC | F | testosterone dehydrogenase (NAD+) activity |
| GO:0006702 | NAS:UniProtKB | P | androgen biosynthetic process |
| GO:0006710 | TAS:UniProtKB | P | androgen catabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_160156 | The canonical retinoid cycle in rods (twilight vision) |
| REACT_160125 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Protein Entry
H17B6_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=0.19 uM for NAD {ECO |
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Catalytic Activity | All-trans-retinol-[cellular-retinol-binding- protein] + NAD(+) = all-trans-retinal-[cellular-retinol-binding- protein] + NADH. |
| Catalytic Activity | Testosterone + NAD(+) = androstenedione + NADH. |
| Function | NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3- alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha- androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids. {ECO |
| Sequence Caution | Sequence=AAB88252.1; Type=Frameshift; Positions=158, 174; Evidence= ; |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Microsome membrane ; Peripheral membrane protein ; Lumenal side . Early endosome membrane {ECO |
| Tissue Specificity | Detected in liver and prostate (at protein level). Detected in adult liver, lung, brain, placenta, prostate, adrenal gland, testis, mammary gland, spleen, spinal cord and uterus. Detected in caudate nucleus, and at lower levels in amygdala, corpus callosum, hippocampus, substantia nigra and thalamus. Detected in fetal lung, liver and brain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006664 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 19743808 | RefSeq | NP_003716 | 317 | 17-beta-hydroxysteroid dehydrogenase type 6 precursor |
Identical Sequences to LMP006664 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19743808 | GenBank | AHE01240.1 | 317 | Sequence 56156 from patent US 8586006 |
| GI:19743808 | GenBank | AIC50163.1 | 317 | HSD17B6, partial [synthetic construct] |
| GI:19743808 | RefSeq | XP_005269264.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X1 [Homo sapiens] |
| GI:19743808 | RefSeq | XP_005269265.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X2 [Homo sapiens] |
| GI:19743808 | RefSeq | XP_005269266.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X3 [Homo sapiens] |
| GI:19743808 | RefSeq | XP_006719735.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X6 [Homo sapiens] |
Related Sequences to LMP006664 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19743808 | DBBJ | BAG36215.1 | 317 | unnamed protein product [Homo sapiens] |
| GI:19743808 | RefSeq | XP_004053439.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Gorilla gorilla gorilla] |
| GI:19743808 | RefSeq | XP_008976794.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus] |
| GI:19743808 | RefSeq | XP_008976795.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus] |
| GI:19743808 | RefSeq | XP_008976796.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus] |
| GI:19743808 | RefSeq | XP_008976797.1 | 317 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus] |