Gene/Proteome Database (LMPD)

LMPD ID
LMP006664
Gene ID
8630
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Gene Symbol
HSD17B6
Synonyms
HSE; RODH; SDR9C6
Alternate Names
17-beta-hydroxysteroid dehydrogenase type 6; 17-beta-HSD 6; oxidoreductase; 3-alpha->beta-HSE; retinol dehydrogenase; 3-hydroxysteroid epimerase; 3-alpha->beta-hydroxysteroid epimerase; 3(alpha->beta)-hydroxysteroid epimerase; 3(alpha->beta)-hydroxysteroid epimerasel; oxidative 3-alpha hydroxysteroid dehydrogenase; oxidative 3-alpha-hydroxysteroid-dehydrogenase; hydroxysteroid (17-beta) dehydrogenase 6 homolog; short chain dehydrogenase/reductase family 9C, member 6; NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
Chromosome
12
Map Location
12q13
EC Number
1.1.1.105
Summary
The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. [provided by RefSeq, Aug 2013]
Orthologs
View orthologs and multiple alignments for HSD17B6

Proteins

17-beta-hydroxysteroid dehydrogenase type 6 precursor
Refseq ID NP_003716
Protein GI 19743808
UniProt ID O14756
mRNA ID NM_003725
Length 317
RefSeq Status REVIEWED
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
sig_peptide: 1..17 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (O14756.1) calculated_mol_wt: 2160 peptide sequence: MWLYLAAFVGLYYLLHW mat_peptide: 18..317 product: 17-beta-hydroxysteroid dehydrogenase type 6 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O14756.1) calculated_mol_wt: 33824 peptide sequence: YRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV

Gene Information

Entrez Gene ID
8630
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Gene Symbol
HSD17B6
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0005622 NAS:UniProtKB C intracellular
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0003824 TAS:ProtInc F catalytic activity
GO:0009055 TAS:UniProtKB F electron carrier activity
GO:0004303 IEA:UniProtKB-EC F estradiol 17-beta-dehydrogenase activity
GO:0016491 NAS:UniProtKB F oxidoreductase activity
GO:0004745 IEA:UniProtKB-EC F retinol dehydrogenase activity
GO:0047035 IEA:UniProtKB-EC F testosterone dehydrogenase (NAD+) activity
GO:0006702 NAS:UniProtKB P androgen biosynthetic process
GO:0006710 TAS:UniProtKB P androgen catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00830 Retinol metabolism
hsa00140 Steroid hormone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_160156 The canonical retinoid cycle in rods (twilight vision)
REACT_160125 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Protein Entry
H17B6_HUMAN
UniProt ID
O14756
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=0.19 uM for NAD {ECO
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Catalytic Activity All-trans-retinol-[cellular-retinol-binding- protein] + NAD(+) = all-trans-retinal-[cellular-retinol-binding- protein] + NADH.
Catalytic Activity Testosterone + NAD(+) = androstenedione + NADH.
Function NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3- alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha- androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids. {ECO
Sequence Caution Sequence=AAB88252.1; Type=Frameshift; Positions=158, 174; Evidence= ;
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Subcellular Location Microsome membrane ; Peripheral membrane protein ; Lumenal side . Early endosome membrane {ECO
Tissue Specificity Detected in liver and prostate (at protein level). Detected in adult liver, lung, brain, placenta, prostate, adrenal gland, testis, mammary gland, spleen, spinal cord and uterus. Detected in caudate nucleus, and at lower levels in amygdala, corpus callosum, hippocampus, substantia nigra and thalamus. Detected in fetal lung, liver and brain.

Identical and Related Proteins

Unique RefSeq proteins for LMP006664 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19743808 RefSeq NP_003716 317 17-beta-hydroxysteroid dehydrogenase type 6 precursor

Identical Sequences to LMP006664 proteins

Reference Database Accession Length Protein Name
GI:19743808 GenBank AHE01240.1 317 Sequence 56156 from patent US 8586006
GI:19743808 GenBank AIC50163.1 317 HSD17B6, partial [synthetic construct]
GI:19743808 RefSeq XP_005269264.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X1 [Homo sapiens]
GI:19743808 RefSeq XP_005269265.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X2 [Homo sapiens]
GI:19743808 RefSeq XP_005269266.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X3 [Homo sapiens]
GI:19743808 RefSeq XP_006719735.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 isoform X6 [Homo sapiens]

Related Sequences to LMP006664 proteins

Reference Database Accession Length Protein Name
GI:19743808 DBBJ BAG36215.1 317 unnamed protein product [Homo sapiens]
GI:19743808 RefSeq XP_004053439.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Gorilla gorilla gorilla]
GI:19743808 RefSeq XP_008976794.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus]
GI:19743808 RefSeq XP_008976795.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus]
GI:19743808 RefSeq XP_008976796.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus]
GI:19743808 RefSeq XP_008976797.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Pan paniscus]