Gene/Proteome Database (LMPD)
LMPD ID
LMP006673
Gene ID
Species
Homo sapiens (Human)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Gene Symbol
Synonyms
SOAT
Alternate Names
solute carrier family 10 member 6; sodium-dependent organic anion transporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 6
Chromosome
4
Map Location
4q21.3
Proteins
| solute carrier family 10 member 6 | |
|---|---|
| Refseq ID | NP_932069 |
| Protein GI | 37537552 |
| UniProt ID | Q3KNW5 |
| mRNA ID | NM_197965 |
| Length | 377 |
| RefSeq Status | VALIDATED |
| MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE | |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0008508 | IEA:InterPro | F | bile acid:sodium symporter activity |
| GO:0043250 | IEA:Ensembl | F | sodium-dependent organic anion transmembrane transporter activity |
| GO:0043251 | IEA:Ensembl | P | sodium-dependent organic anion transport |
| GO:0055085 | TAS:Reactome | P | transmembrane transport |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11040 | Bile acid and bile salt metabolism |
| REACT_11042 | Recycling of bile acids and salts |
| REACT_19118 | SLC-mediated transmembrane transport |
| REACT_19305 | Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds |
Domain Information
UniProt Annotations
Entry Information
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 6
Protein Entry
SOAT_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Transports sulfoconjugated steroid hormones, as well as taurolithocholic acid-3-sulfate and sulfoconjugated pyrenes in a sodium-dependent manner. |
| Ptm | Glycosylated. |
| Similarity | Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Highly expressed in testis, placenta and pancreas. Moderately expressed in heart, lung and mammary gland. Weakly expressed in brain, colon, kidney, liver, ovary, prostate, small intestine, spleen and thymus. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006673 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 37537552 | RefSeq | NP_932069 | 377 | solute carrier family 10 member 6 |
Identical Sequences to LMP006673 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:37537552 | EMBL | CAE47477.1 | 377 | sodium-dependent organic anion transporter [Homo sapiens] |
| GI:37537552 | GenBank | EAX05969.1 | 377 | solute carrier family 10 (sodium/bile acid cotransporter family), member 6, partial [Homo sapiens] |
| GI:37537552 | GenBank | ABO38126.1 | 377 | sodium-dependent organic anion transporter [Homo sapiens] |
| GI:37537552 | GenBank | ADS13337.1 | 377 | Sequence 1 from patent US 7754856 |
| GI:37537552 | SwissProt | Q3KNW5.2 | 377 | RecName: Full=Solute carrier family 10 member 6; AltName: Full=Sodium-dependent organic anion transporter [Homo sapiens] |
Related Sequences to LMP006673 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:37537552 | GenBank | AAI07052.1 | 377 | Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Homo sapiens] |
| GI:37537552 | GenBank | AAI07053.1 | 377 | Solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Homo sapiens] |
| GI:37537552 | GenBank | ADS13338.1 | 377 | Sequence 14 from patent US 7754856 |
| GI:37537552 | GenBank | AIC58189.1 | 377 | SLC10A6, partial [synthetic construct] |
| GI:37537552 | RefSeq | XP_526626.2 | 377 | PREDICTED: solute carrier family 10 member 6 [Pan troglodytes] |
| GI:37537552 | RefSeq | XP_003811299.1 | 377 | PREDICTED: solute carrier family 10 member 6 [Pan paniscus] |