Gene/Proteome Database (LMPD)

LMPD ID
LMP006678
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Gene Symbol
Synonyms
SIAT7-F; SIAT7F; ST6GALNACVI
Chromosome
9
Map Location
9q34.11
EC Number
2.4.99.-
Summary
ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM, Mar 2008]
Orthologs

Proteins

alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform a
Refseq ID NP_038471
Protein GI 21361444
UniProt ID Q969X2
mRNA ID NM_013443
Length 333
RefSeq Status VALIDATED
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform b
Refseq ID NP_001273928
Protein GI 558757381
UniProt ID Q969X2
mRNA ID NM_001286999
Length 374
RefSeq Status VALIDATED
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSGPASSACPTTTTSPRGRTNVSPTSRMSTVARATTTASSPRKGSSHRGPSCMASPSPTPPGPRPPSLWDLRRVRGEAASAQPLGQGPSSGQSRLAGVSPSQSGP
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c
Refseq ID NP_001273930
Protein GI 558757331
UniProt ID Q969X2
mRNA ID NM_001287001
Length 299
RefSeq Status VALIDATED
MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c
Refseq ID NP_001273929
Protein GI 558757373
UniProt ID Q969X2
mRNA ID NM_001287000
Length 299
RefSeq Status VALIDATED
Protein sequence is identical to GI:558757331 (mRNA isoform)
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c
Refseq ID NP_001273931
Protein GI 558757369
UniProt ID Q969X2
mRNA ID NM_001287002
Length 299
RefSeq Status VALIDATED
Protein sequence is identical to GI:558757331 (mRNA isoform)
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform d
Refseq ID NP_001273932
Protein GI 558757386
UniProt ID Q969X2
mRNA ID NM_001287003
Length 86
RefSeq Status VALIDATED
MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKGEVSFVVEHRLVYHGDRGGVV

Gene Information

Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005737 ISS:BHF-UCL C cytoplasm
GO:0016021 TAS:ProtInc C integral component of membrane
GO:0005886 NAS:ProtInc C plasma membrane
GO:0001665 ISS:BHF-UCL F alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity
GO:0008373 IDA:BHF-UCL F sialyltransferase activity
GO:0009988 IC:BHF-UCL P cell-cell recognition
GO:0001574 ISS:BHF-UCL P ganglioside biosynthetic process
GO:0009100 IDA:BHF-UCL P glycoprotein metabolic process
GO:0006687 IDA:BHF-UCL P glycosphingolipid metabolic process
GO:0006677 IDA:BHF-UCL P glycosylceramide metabolic process
GO:0009312 ISS:BHF-UCL P oligosaccharide biosynthetic process
GO:0006486 IEA:InterPro P protein glycosylation
GO:0097503 IDA:GOC P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
hsa01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_200874 Sialic acid metabolism
REACT_22387 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29

UniProt Annotations

Entry Information

Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Protein Entry
SIA7F_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q969X2-1; Sequence=Displayed; Name=2; IsoId=Q969X2-2; Sequence=VSP_030359; Name=3; IsoId=Q969X2-3; Sequence=VSP_055722;
Biophysicochemical Properties Kinetic parameters: KM=0.33 mM for GM1b ; KM=0.46 mM for sialyl-Lc4 ;
Function Alpha-2,6-sialyltransferase involved in the synthesis of alpha-series gangliosides. Has activity toward GD1a, GT1b and GM1b. Has no activity toward glycoproteins. Responsible for the biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. Participates in the synthesis of disialyl Lewis a (Le(a)).
Induction Down-regulated in renal cancers.
Miscellaneous The carbohydrate antigen disialyl Lewis a, which is at least partly synthesized by ST6GALNAC6, is a normal counterpart of sialyl Lewis a, better known as CA19-9, an antigen widely used as a serum marker for diagnosis of cancers in the digestive track. Disialyl Lewis a is predominantly expressed in non-malignant epithelial cells of the digestive organs, while sialyl Lewis a is preferentially expressed in cancers. Disialyl Lewis a in normal epithelial cells serves as a ligand for immunosuppressive receptors, such as SIGLEC7 and SIGLEC9, expressed on resident monocytes/macrophages and maintains immunological homeostasis of mucosal membranes in digestive organs. Sialyl Lewis a, as well as its positional isomer sialyl Lewis x, serves as a ligand for vascular cell adhesion molecule E-selectin and facilitates hematogenous metastasis through mediating adhesion of circulating cancer cells to vascular endothelium (PubMed:17760270).
Sequence Caution Sequence=CAI12610.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAI12611.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=EAW87712.1; Type=Erroneous gene model prediction; Evidence= ;
Similarity Belongs to the glycosyltransferase 29 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Expressed in kidney, in proximal tubule epithelial cells. Expressed in colon cell lines.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST6GalNAc VI; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_635";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST6GALNAC6";

Identical and Related Proteins

Unique RefSeq proteins for LMP006678 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21361444 RefSeq NP_038471 333 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform a
558757381 RefSeq NP_001273928 374 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform b
558757331 RefSeq NP_001273930 299 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c
558757386 RefSeq NP_001273932 86 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform d

Identical Sequences to LMP006678 proteins

Reference Database Accession Length Protein Name
GI:21361444 EMBL CAS91687.1 333 unnamed protein product [Homo sapiens]
GI:21361444 GenBank AAH16299.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Homo sapiens]
GI:558757381 GenBank EAW87712.1 374 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_c [Homo sapiens]
GI:21361444 GenBank EAW87714.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_e [Homo sapiens]
GI:558757331 GenBank ADL91349.1 299 Sequence 206 from patent US 7709602
GI:558757331 GenBank ADL91659.1 299 Sequence 206 from patent US 7709603
GI:558757331 GenBank ADL97740.1 299 Sequence 206 from patent US 7718770
GI:21361444 GenBank ADZ15865.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, partial [synthetic construct]
GI:558757331 GenBank AEU55187.1 299 Sequence 206 from patent US 8063186
GI:21361444 GenBank AIC51325.1 333 ST6GALNAC6, partial [synthetic construct]
GI:558757331 RefSeq NP_001273931.1 299 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c [Homo sapiens]
GI:558757331 RefSeq NP_001273929.1 299 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c [Homo sapiens]
GI:558757386 RefSeq XP_009001603.1 86 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Callithrix jacchus]
GI:21361444 SwissProt Q969X2.1 333 RecName: Full=Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; AltName: Full=GalNAc alpha-2,6-sialyltransferase VI; AltName: Full=ST6GalNAc VI; Short=ST6GalNAcVI; Short=hST6GalNAc VI; AltName: Full=Sialyltransferase 7F; Short=SIAT7-F [Homo sapiens]

Related Sequences to LMP006678 proteins

Reference Database Accession Length Protein Name
GI:558757331 GenBank AAH07802.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Homo sapiens]
GI:558757331 GenBank AAH06564.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Homo sapiens]
GI:21361444 GenBank EAW87710.1 392 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_a, partial [Homo sapiens]
GI:558757331 GenBank EAW87714.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_e [Homo sapiens]
GI:558757331 GenBank ADZ15865.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, partial [synthetic construct]
GI:21361444 GenBank JAA06948.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Pan troglodytes]
GI:21361444 GenBank JAA17453.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Pan troglodytes]
GI:21361444 GenBank JAA31204.1 333 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Pan troglodytes]
GI:558757331 GenBank AIC51325.1 333 ST6GALNAC6, partial [synthetic construct]
GI:558757331 RefSeq NP_038471.2 333 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform a [Homo sapiens]
GI:558757381 RefSeq XP_006717151.1 399 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X3 [Homo sapiens]
GI:558757381 RefSeq XP_006717152.1 340 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Homo sapiens]
GI:558757381 RefSeq XP_006717153.1 340 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X5 [Homo sapiens]
GI:558757386 RefSeq XP_006717154.1 145 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X6 [Homo sapiens]
GI:558757386 RefSeq XP_006717155.1 145 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X7 [Homo sapiens]
GI:558757386 RefSeq XP_009001599.1 120 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X3 [Callithrix jacchus]
GI:21361444 RefSeq XP_008974069.1 333 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X1 [Pan paniscus]
GI:558757381 RefSeq XP_008974076.1 374 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X3 [Pan paniscus]
GI:558757386 RefSeq XP_009187379.1 120 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Papio anubis]
GI:558757386 RefSeq XP_009187380.1 120 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Papio anubis]
GI:558757386 RefSeq XP_009187381.1 86 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X5 [Papio anubis]
GI:558757381 RefSeq XP_010349620.1 346 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X1 [Saimiri boliviensis boliviensis]
GI:558757381 RefSeq XP_010349621.1 346 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X1 [Saimiri boliviensis boliviensis]
GI:21361444 RefSeq XP_010349622.1 333 PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X2 [Saimiri boliviensis boliviensis]