Gene/Proteome Database (LMPD)
LMPD ID
LMP006678
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Gene Symbol
Synonyms
SIAT7-F; SIAT7F; ST6GALNACVI
Chromosome
9
Map Location
9q34.11
EC Number
2.4.99.-
Summary
ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform a | |
---|---|
Refseq ID | NP_038471 |
Protein GI | 21361444 |
UniProt ID | Q969X2 |
mRNA ID | NM_013443 |
Length | 333 |
RefSeq Status | VALIDATED |
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform b | |
---|---|
Refseq ID | NP_001273928 |
Protein GI | 558757381 |
UniProt ID | Q969X2 |
mRNA ID | NM_001286999 |
Length | 374 |
RefSeq Status | VALIDATED |
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSGPASSACPTTTTSPRGRTNVSPTSRMSTVARATTTASSPRKGSSHRGPSCMASPSPTPPGPRPPSLWDLRRVRGEAASAQPLGQGPSSGQSRLAGVSPSQSGP |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c | |
---|---|
Refseq ID | NP_001273930 |
Protein GI | 558757331 |
UniProt ID | Q969X2 |
mRNA ID | NM_001287001 |
Length | 299 |
RefSeq Status | VALIDATED |
MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c | |
---|---|
Refseq ID | NP_001273929 |
Protein GI | 558757373 |
UniProt ID | Q969X2 |
mRNA ID | NM_001287000 |
Length | 299 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:558757331 (mRNA isoform) |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c | |
---|---|
Refseq ID | NP_001273931 |
Protein GI | 558757369 |
UniProt ID | Q969X2 |
mRNA ID | NM_001287002 |
Length | 299 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:558757331 (mRNA isoform) |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform d | |
---|---|
Refseq ID | NP_001273932 |
Protein GI | 558757386 |
UniProt ID | Q969X2 |
mRNA ID | NM_001287003 |
Length | 86 |
RefSeq Status | VALIDATED |
MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKGEVSFVVEHRLVYHGDRGGVV |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0005737 | ISS:BHF-UCL | C | cytoplasm |
GO:0016021 | TAS:ProtInc | C | integral component of membrane |
GO:0005886 | NAS:ProtInc | C | plasma membrane |
GO:0001665 | ISS:BHF-UCL | F | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity |
GO:0008373 | IDA:BHF-UCL | F | sialyltransferase activity |
GO:0009988 | IC:BHF-UCL | P | cell-cell recognition |
GO:0001574 | ISS:BHF-UCL | P | ganglioside biosynthetic process |
GO:0009100 | IDA:BHF-UCL | P | glycoprotein metabolic process |
GO:0006687 | IDA:BHF-UCL | P | glycosphingolipid metabolic process |
GO:0006677 | IDA:BHF-UCL | P | glycosylceramide metabolic process |
GO:0009312 | ISS:BHF-UCL | P | oligosaccharide biosynthetic process |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
GO:0097503 | IDA:GOC | P | sialylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa01100 | Metabolic pathways |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_200874 | Sialic acid metabolism |
REACT_22387 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Protein Entry
SIA7F_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q969X2-1; Sequence=Displayed; Name=2; IsoId=Q969X2-2; Sequence=VSP_030359; Name=3; IsoId=Q969X2-3; Sequence=VSP_055722; |
Biophysicochemical Properties | Kinetic parameters: KM=0.33 mM for GM1b ; KM=0.46 mM for sialyl-Lc4 ; |
Function | Alpha-2,6-sialyltransferase involved in the synthesis of alpha-series gangliosides. Has activity toward GD1a, GT1b and GM1b. Has no activity toward glycoproteins. Responsible for the biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. Participates in the synthesis of disialyl Lewis a (Le(a)). |
Induction | Down-regulated in renal cancers. |
Miscellaneous | The carbohydrate antigen disialyl Lewis a, which is at least partly synthesized by ST6GALNAC6, is a normal counterpart of sialyl Lewis a, better known as CA19-9, an antigen widely used as a serum marker for diagnosis of cancers in the digestive track. Disialyl Lewis a is predominantly expressed in non-malignant epithelial cells of the digestive organs, while sialyl Lewis a is preferentially expressed in cancers. Disialyl Lewis a in normal epithelial cells serves as a ligand for immunosuppressive receptors, such as SIGLEC7 and SIGLEC9, expressed on resident monocytes/macrophages and maintains immunological homeostasis of mucosal membranes in digestive organs. Sialyl Lewis a, as well as its positional isomer sialyl Lewis x, serves as a ligand for vascular cell adhesion molecule E-selectin and facilitates hematogenous metastasis through mediating adhesion of circulating cancer cells to vascular endothelium (PubMed:17760270). |
Sequence Caution | Sequence=CAI12610.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAI12611.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=EAW87712.1; Type=Erroneous gene model prediction; Evidence= ; |
Similarity | Belongs to the glycosyltransferase 29 family. |
Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Tissue Specificity | Expressed in kidney, in proximal tubule epithelial cells. Expressed in colon cell lines. |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST6GalNAc VI; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_635"; |
Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST6GALNAC6"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP006678 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21361444 | RefSeq | NP_038471 | 333 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform a |
558757381 | RefSeq | NP_001273928 | 374 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform b |
558757331 | RefSeq | NP_001273930 | 299 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c |
558757386 | RefSeq | NP_001273932 | 86 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform d |
Identical Sequences to LMP006678 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21361444 | EMBL | CAS91687.1 | 333 | unnamed protein product [Homo sapiens] |
GI:21361444 | GenBank | AAH16299.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Homo sapiens] |
GI:558757381 | GenBank | EAW87712.1 | 374 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_c [Homo sapiens] |
GI:21361444 | GenBank | EAW87714.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_e [Homo sapiens] |
GI:558757331 | GenBank | ADL91349.1 | 299 | Sequence 206 from patent US 7709602 |
GI:558757331 | GenBank | ADL91659.1 | 299 | Sequence 206 from patent US 7709603 |
GI:558757331 | GenBank | ADL97740.1 | 299 | Sequence 206 from patent US 7718770 |
GI:21361444 | GenBank | ADZ15865.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, partial [synthetic construct] |
GI:558757331 | GenBank | AEU55187.1 | 299 | Sequence 206 from patent US 8063186 |
GI:21361444 | GenBank | AIC51325.1 | 333 | ST6GALNAC6, partial [synthetic construct] |
GI:558757331 | RefSeq | NP_001273931.1 | 299 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c [Homo sapiens] |
GI:558757331 | RefSeq | NP_001273929.1 | 299 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform c [Homo sapiens] |
GI:558757386 | RefSeq | XP_009001603.1 | 86 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Callithrix jacchus] |
GI:21361444 | SwissProt | Q969X2.1 | 333 | RecName: Full=Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; AltName: Full=GalNAc alpha-2,6-sialyltransferase VI; AltName: Full=ST6GalNAc VI; Short=ST6GalNAcVI; Short=hST6GalNAc VI; AltName: Full=Sialyltransferase 7F; Short=SIAT7-F [Homo sapiens] |
Related Sequences to LMP006678 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:558757331 | GenBank | AAH07802.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Homo sapiens] |
GI:558757331 | GenBank | AAH06564.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Homo sapiens] |
GI:21361444 | GenBank | EAW87710.1 | 392 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_a, partial [Homo sapiens] |
GI:558757331 | GenBank | EAW87714.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, isoform CRA_e [Homo sapiens] |
GI:558757331 | GenBank | ADZ15865.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, partial [synthetic construct] |
GI:21361444 | GenBank | JAA06948.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Pan troglodytes] |
GI:21361444 | GenBank | JAA17453.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Pan troglodytes] |
GI:21361444 | GenBank | JAA31204.1 | 333 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [Pan troglodytes] |
GI:558757331 | GenBank | AIC51325.1 | 333 | ST6GALNAC6, partial [synthetic construct] |
GI:558757331 | RefSeq | NP_038471.2 | 333 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform a [Homo sapiens] |
GI:558757381 | RefSeq | XP_006717151.1 | 399 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X3 [Homo sapiens] |
GI:558757381 | RefSeq | XP_006717152.1 | 340 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Homo sapiens] |
GI:558757381 | RefSeq | XP_006717153.1 | 340 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X5 [Homo sapiens] |
GI:558757386 | RefSeq | XP_006717154.1 | 145 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X6 [Homo sapiens] |
GI:558757386 | RefSeq | XP_006717155.1 | 145 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X7 [Homo sapiens] |
GI:558757386 | RefSeq | XP_009001599.1 | 120 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X3 [Callithrix jacchus] |
GI:21361444 | RefSeq | XP_008974069.1 | 333 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X1 [Pan paniscus] |
GI:558757381 | RefSeq | XP_008974076.1 | 374 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X3 [Pan paniscus] |
GI:558757386 | RefSeq | XP_009187379.1 | 120 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Papio anubis] |
GI:558757386 | RefSeq | XP_009187380.1 | 120 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X4 [Papio anubis] |
GI:558757386 | RefSeq | XP_009187381.1 | 86 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X5 [Papio anubis] |
GI:558757381 | RefSeq | XP_010349620.1 | 346 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X1 [Saimiri boliviensis boliviensis] |
GI:558757381 | RefSeq | XP_010349621.1 | 346 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X1 [Saimiri boliviensis boliviensis] |
GI:21361444 | RefSeq | XP_010349622.1 | 333 | PREDICTED: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 isoform X2 [Saimiri boliviensis boliviensis] |