Gene/Proteome Database (LMPD)

LMPD ID
LMP006739
Gene ID
1646
Species
Homo sapiens (Human)
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
AKR1C2
Synonyms
AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD
Alternate Names
aldo-keto reductase family 1 member C2; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; testicular 17,20-desmolase deficiency; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III
Chromosome
10
Map Location
10p15-p14
EC Number
1.-.-.-
Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Orthologs
View orthologs and multiple alignments for AKR1C2

Proteins

aldo-keto reductase family 1 member C2 isoform 1
Refseq ID NP_001345
Protein GI 4503285
UniProt ID P52895
mRNA ID NM_001354
Length 323
RefSeq Status REVIEWED
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
aldo-keto reductase family 1 member C2 isoform 1
Refseq ID NP_995317
Protein GI 45446745
UniProt ID P52895
mRNA ID NM_205845
Length 323
RefSeq Status REVIEWED
Protein sequence is identical to GI:4503285 (mRNA isoform)
aldo-keto reductase family 1 member C2 isoform 2
Refseq ID NP_001128713
Protein GI 207028673
UniProt ID P52895
mRNA ID NM_001135241
Length 139
RefSeq Status REVIEWED
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKEDIGILTWKKSPKHNS

Gene Information

Entrez Gene ID
1646
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
AKR1C2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0004032 IDA:UniProtKB F alditol:NADP+ 1-oxidoreductase activity
GO:0032052 IDA:UniProtKB F bile acid binding
GO:0031406 IDA:UniProtKB F carboxylic acid binding
GO:0047086 IDA:UniProtKB F ketosteroid monooxygenase activity
GO:0016655 IDA:UniProtKB F oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0018636 IDA:UniProtKB F phenanthrene 9,10-monooxygenase activity
GO:0004958 IDA:UniProtKB F prostaglandin F receptor activity
GO:0047115 IDA:UniProtKB F trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity
GO:0007186 IDA:UniProtKB P G-protein coupled receptor signaling pathway
GO:0071395 IDA:UniProtKB P cellular response to jasmonic acid stimulus
GO:0044597 IMP:UniProtKB P daunorubicin metabolic process
GO:0007586 IDA:UniProtKB P digestion
GO:0044598 IMP:UniProtKB P doxorubicin metabolic process
GO:0030855 IEP:UniProt P epithelial cell differentiation
GO:0055114 IDA:UniProtKB P oxidation-reduction process
GO:0008284 IDA:UniProtKB P positive regulation of cell proliferation
GO:0051897 IDA:UniProtKB P positive regulation of protein kinase B signaling
GO:0042448 IDA:UniProtKB P progesterone metabolic process
GO:0006693 IDA:UniProtKB P prostaglandin metabolic process
GO:0034694 IDA:UniProtKB P response to prostaglandin
GO:0008202 IDA:UniProtKB P steroid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05204 Chemical carcinogenesis
hsa00140 Steroid hormone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_11048 Synthesis of bile acids and bile salts via 27-hydroxycholesterol

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member C2
Protein Entry
AK1C2_HUMAN
UniProt ID
P52895
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P52895-1; Sequence=Displayed; Name=2; IsoId=P52895-2; Sequence=VSP_043779, VSP_043780; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: KM=260 uM for (s)-tetralol ; KM=520 uM for (s)-indan-1-ol ; KM=5000 uM for benzene dihydrodiol ; KM=1 uM for 5-beta-pregnane-3-alpha,20-alpha-diol ; KM=208 uM for 9-alpha,11-beta-PGF2 ; KM=0.3 uM for 5-beta-androstane-3,17-dione ; KM=79 uM for PGD2 ;
Catalytic Activity A 3-alpha-hydroxysteroid + NAD(P)(+) = a 3- oxosteroid + NAD(P)H.
Catalytic Activity Trans-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + NADPH.
Disease 46,XY sex reversal 8 (SRXY8) [MIM
Enzyme Regulation Inhibited by hexestrol with an IC(50) of 2.8 uM, 1,10-phenanthroline with an IC(50) of 2100 uM, 1,7- phenanthroline with an IC(50) of 1500 uM, flufenamic acid with an IC(50) of 0.9 uM, indomethacin with an IC(50) of 75 uM, ibuprofen with an IC(50) of 6.9 uM, lithocholic acid with an IC(50) of 0.07 uM, ursodeoxycholic acid with an IC(50) of 0.08 uM and chenodeoxycholic acid with an IC(50) of 0.13 uM.
Function Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha- DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability. {ECO
Similarity Belongs to the aldo/keto reductase family.
Subcellular Location Cytoplasm .
Tissue Specificity Expressed in fetal testes. Expressed in fetal and adult adrenal glands.

Identical and Related Proteins

Unique RefSeq proteins for LMP006739 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4503285 RefSeq NP_001345 323 aldo-keto reductase family 1 member C2 isoform 1
207028673 RefSeq NP_001128713 139 aldo-keto reductase family 1 member C2 isoform 2

Identical Sequences to LMP006739 proteins

Reference Database Accession Length Protein Name
GI:207028673 DBBJ BAG59281.1 139 unnamed protein product [Homo sapiens]
GI:4503285 GenBank ADT47546.1 323 Sequence 1207 from patent US 7842466
GI:4503285 GenBank AEN35373.1 323 Sequence 1301 from patent US 7998689
GI:4503285 GenBank AHD75593.1 323 Sequence 17976 from patent US 8586006
GI:4503285 GenBank AHD75594.1 323 Sequence 17977 from patent US 8586006
GI:4503285 GenBank AIC48626.1 323 AKR1C2, partial [synthetic construct]
GI:4503285 GenBank AIC62976.1 323 AKR1C2, partial [synthetic construct]

Related Sequences to LMP006739 proteins

Reference Database Accession Length Protein Name
GI:4503285 GenBank AAP36771.1 324 Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III), partial [synthetic construct]
GI:4503285 GenBank AAX29399.1 324 aldo-keto reductase family 1 member C2, partial [synthetic construct]
GI:4503285 GenBank AAX29400.1 324 aldo-keto reductase family 1 member C2, partial [synthetic construct]
GI:207028673 GenBank ADT47546.1 323 Sequence 1207 from patent US 7842466
GI:207028673 GenBank AIC48626.1 323 AKR1C2, partial [synthetic construct]
GI:4503285 PDB 4JQ1 331 Chain B, Akr1c2 Complex With Naproxen
GI:4503285 PDB 4JQ2 331 Chain A, Akr1c2 Complex With Sulindac
GI:4503285 PDB 4JQ2 331 Chain B, Akr1c2 Complex With Sulindac
GI:207028673 RefSeq XP_004049051.1 139 PREDICTED: aldo-keto reductase family 1 member C1-like [Gorilla gorilla gorilla]
GI:207028673 RefSeq XP_005564596.1 139 PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X3 [Macaca fascicularis]
GI:207028673 RefSeq XP_010382635.1 139 PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X3 [Rhinopithecus roxellana]
GI:207028673 SwissProt P52895.3 323 RecName: Full=Aldo-keto reductase family 1 member C2; AltName: Full=3-alpha-HSD3; AltName: Full=Chlordecone reductase homolog HAKRD; AltName: Full=Dihydrodiol dehydrogenase 2; Short=DD-2; Short=DD2; AltName: Full=Dihydrodiol dehydrogenase/bile acid-binding protein; Short=DD/BABP; AltName: Full=Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; AltName: Full=Type III 3-alpha-hydroxysteroid dehydrogenase [Homo sapiens]