Gene/Proteome Database (LMPD)

LMPD ID
LMP006743
Gene ID
8694
Species
Homo sapiens (Human)
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
DGAT1
Synonyms
ARAT; ARGP1; DGAT; DIAR7
Alternate Names
diacylglycerol O-acyltransferase 1; ACAT related gene product 1; diglyceride acyltransferase; acyl-CoA:diacylglycerol acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; acyl coenzyme A:cholesterol acyltransferase related gene 1
Chromosome
8
Map Location
8q24.3
EC Number
2.3.1.20
Summary
This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases. [provided by RefSeq, Jul 2013]
Orthologs
View orthologs and multiple alignments for DGAT1

Proteins

diacylglycerol O-acyltransferase 1
Refseq ID NP_036211
Protein GI 145864459
UniProt ID O75907
mRNA ID NM_012079
Length 488
RefSeq Status REVIEWED
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA

Gene Information

Entrez Gene ID
8694
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
DGAT1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 ISS:BHF-UCL C integral component of membrane
GO:0004144 IDA:MGI F diacylglycerol O-acyltransferase activity
GO:0050252 IEA:UniProtKB-EC F retinol O-fatty-acyltransferase activity
GO:0016746 TAS:ProtInc F transferase activity, transferring acyl groups
GO:0036155 TAS:Reactome P acylglycerol acyl-chain remodeling
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0046339 ISS:BHF-UCL P diacylglycerol metabolic process
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0019915 ISS:BHF-UCL P lipid storage
GO:0035336 ISS:BHF-UCL P long-chain fatty-acyl-CoA metabolic process
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0019432 IDA:UniProtKB P triglyceride biosynthetic process
GO:0006641 TAS:ProtInc P triglyceride metabolic process
GO:0034379 IMP:BHF-UCL P very-low-density lipoprotein particle assembly

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121122 Acyl chain remodeling of DAG and TAG

Domain Information

InterPro Annotations

Accession Description
IPR027251 Diacylglycerol O-acyltransferase 1
IPR004299 Membrane bound O-acyl transferase, MBOAT
IPR014371 Sterol O-acyltransferase, ACAT/DAG/ARE types

UniProt Annotations

Entry Information

Gene Name
diacylglycerol O-acyltransferase 1
Protein Entry
DGAT1_HUMAN
UniProt ID
O75907
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=25.9 uM for retinol ; KM=13.9 uM for palmitoyl coenzyme A ;
Catalytic Activity Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.
Catalytic Activity Acyl-CoA + retinol = CoA + retinyl ester.
Disease Diarrhea 7 (DIAR7) [MIM
Enzyme Regulation XP620 is a selective DGAT1 inhibitor.
Function Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. {ECO
Interaction Q99IB8:- (xeno); NbExp=2; IntAct=EBI-3906527, EBI-6927873;
Pathway Lipid metabolism; glycerolipid metabolism.
Similarity Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
Subcellular Location Endoplasmic reticulum membrane {ECO
Subunit Homodimer or homotetramer.

Identical and Related Proteins

Unique RefSeq proteins for LMP006743 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
145864459 RefSeq NP_036211 488 diacylglycerol O-acyltransferase 1

Identical Sequences to LMP006743 proteins

Reference Database Accession Length Protein Name
GI:145864459 GenBank JAA00473.1 488 diacylglycerol O-acyltransferase 1 [Pan troglodytes]
GI:145864459 GenBank JAA21664.1 488 diacylglycerol O-acyltransferase 1 [Pan troglodytes]
GI:145864459 GenBank JAA22485.1 488 diacylglycerol O-acyltransferase 1 [Pan troglodytes]
GI:145864459 GenBank JAA40916.1 488 diacylglycerol O-acyltransferase 1 [Pan troglodytes]
GI:145864459 RefSeq XP_003819477.1 488 PREDICTED: diacylglycerol O-acyltransferase 1 isoform X1 [Pan paniscus]
GI:145864459 RefSeq XP_009454421.1 488 PREDICTED: diacylglycerol O-acyltransferase 1 [Pan troglodytes]

Related Sequences to LMP006743 proteins

Reference Database Accession Length Protein Name
GI:145864459 DBBJ BAF97610.1 488 diacylglycerol acyltransferase [eukaryotic synthetic construct]
GI:145864459 GenBank AAC63997.1 488 ACAT related gene product 1 [Homo sapiens]
GI:145864459 GenBank ABE24126.1 488 Sequence 5 from patent US 7015373
GI:145864459 GenBank ACC37853.1 488 Sequence 5 from patent US 7355097
GI:145864459 GenBank ACQ20583.1 488 Sequence 5 from patent US 7511189
GI:145864459 GenBank ADR93303.1 488 Sequence 29 from patent US 7745691