Gene/Proteome Database (LMPD)
LMPD ID
LMP006743
Gene ID
Species
Homo sapiens (Human)
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
Synonyms
ARAT; ARGP1; DGAT; DIAR7
Alternate Names
diacylglycerol O-acyltransferase 1; ACAT related gene product 1; diglyceride acyltransferase; acyl-CoA:diacylglycerol acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; acyl coenzyme A:cholesterol acyltransferase related gene 1
Chromosome
8
Map Location
8q24.3
EC Number
2.3.1.20
Summary
This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases. [provided by RefSeq, Jul 2013]
Orthologs
Proteins
| diacylglycerol O-acyltransferase 1 | |
|---|---|
| Refseq ID | NP_036211 |
| Protein GI | 145864459 |
| UniProt ID | O75907 |
| mRNA ID | NM_012079 |
| Length | 488 |
| RefSeq Status | REVIEWED |
| MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | ISS:BHF-UCL | C | integral component of membrane |
| GO:0004144 | IDA:MGI | F | diacylglycerol O-acyltransferase activity |
| GO:0050252 | IEA:UniProtKB-EC | F | retinol O-fatty-acyltransferase activity |
| GO:0016746 | TAS:ProtInc | F | transferase activity, transferring acyl groups |
| GO:0036155 | TAS:Reactome | P | acylglycerol acyl-chain remodeling |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0046339 | ISS:BHF-UCL | P | diacylglycerol metabolic process |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0019915 | ISS:BHF-UCL | P | lipid storage |
| GO:0035336 | ISS:BHF-UCL | P | long-chain fatty-acyl-CoA metabolic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019432 | IDA:UniProtKB | P | triglyceride biosynthetic process |
| GO:0006641 | TAS:ProtInc | P | triglyceride metabolic process |
| GO:0034379 | IMP:BHF-UCL | P | very-low-density lipoprotein particle assembly |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04975 | Fat digestion and absorption |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121122 | Acyl chain remodeling of DAG and TAG |
Domain Information
UniProt Annotations
Entry Information
Gene Name
diacylglycerol O-acyltransferase 1
Protein Entry
DGAT1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=25.9 uM for retinol ; KM=13.9 uM for palmitoyl coenzyme A ; |
| Catalytic Activity | Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol. |
| Catalytic Activity | Acyl-CoA + retinol = CoA + retinyl ester. |
| Disease | Diarrhea 7 (DIAR7) [MIM |
| Enzyme Regulation | XP620 is a selective DGAT1 inhibitor. |
| Function | Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. {ECO |
| Interaction | Q99IB8:- (xeno); NbExp=2; IntAct=EBI-3906527, EBI-6927873; |
| Pathway | Lipid metabolism; glycerolipid metabolism. |
| Similarity | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
| Subunit | Homodimer or homotetramer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006743 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145864459 | RefSeq | NP_036211 | 488 | diacylglycerol O-acyltransferase 1 |
Identical Sequences to LMP006743 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145864459 | GenBank | JAA00473.1 | 488 | diacylglycerol O-acyltransferase 1 [Pan troglodytes] |
| GI:145864459 | GenBank | JAA21664.1 | 488 | diacylglycerol O-acyltransferase 1 [Pan troglodytes] |
| GI:145864459 | GenBank | JAA22485.1 | 488 | diacylglycerol O-acyltransferase 1 [Pan troglodytes] |
| GI:145864459 | GenBank | JAA40916.1 | 488 | diacylglycerol O-acyltransferase 1 [Pan troglodytes] |
| GI:145864459 | RefSeq | XP_003819477.1 | 488 | PREDICTED: diacylglycerol O-acyltransferase 1 isoform X1 [Pan paniscus] |
| GI:145864459 | RefSeq | XP_009454421.1 | 488 | PREDICTED: diacylglycerol O-acyltransferase 1 [Pan troglodytes] |
Related Sequences to LMP006743 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145864459 | DBBJ | BAF97610.1 | 488 | diacylglycerol acyltransferase [eukaryotic synthetic construct] |
| GI:145864459 | GenBank | AAC63997.1 | 488 | ACAT related gene product 1 [Homo sapiens] |
| GI:145864459 | GenBank | ABE24126.1 | 488 | Sequence 5 from patent US 7015373 |
| GI:145864459 | GenBank | ACC37853.1 | 488 | Sequence 5 from patent US 7355097 |
| GI:145864459 | GenBank | ACQ20583.1 | 488 | Sequence 5 from patent US 7511189 |
| GI:145864459 | GenBank | ADR93303.1 | 488 | Sequence 29 from patent US 7745691 |