Gene/Proteome Database (LMPD)
LMPD ID
LMP006763
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class U
Gene Symbol
Synonyms
CDC91L1; GAB1
Alternate Names
phosphatidylinositol glycan anchor biosynthesis class U protein; protein CDC91-like 1; GPI transamidase subunit; GPI transamidase component PIG-U; cell division cycle 91-like 1 protein; cell division cycle protein 91-like 1; CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1
Chromosome
20
Map Location
20q11.22
Summary
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| phosphatidylinositol glycan anchor biosynthesis class U protein precursor | |
|---|---|
| Refseq ID | NP_536724 |
| Protein GI | 17998700 |
| UniProt ID | Q9H490 |
| mRNA ID | NM_080476 |
| Length | 435 |
| RefSeq Status | REVIEWED |
| MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK | |
| sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1722 peptide sequence: MAAPLVLVLVVAVTVRA | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class U
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042765 | IDA:UniProtKB | C | GPI-anchor transamidase complex |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0030176 | IC:UniProtKB | C | integral component of endoplasmic reticulum membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005886 | IDA:HGNC | C | plasma membrane |
| GO:0006501 | TAS:Reactome | P | C-terminal protein lipidation |
| GO:0006506 | IDA:HGNC | P | GPI anchor biosynthetic process |
| GO:0016255 | IMP:UniProtKB | P | attachment of GPI anchor to protein |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0043687 | TAS:Reactome | P | post-translational protein modification |
| GO:0046425 | IDA:HGNC | P | regulation of JAK-STAT cascade |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| hsa01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_1830 | Attachment of GPI anchor to uPAR |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009600 | GPI transamidase subunit PIG-U |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class U
Protein Entry
PIGU_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H490-1; Sequence=Displayed; Name=2; IsoId=Q9H490-2; Sequence=VSP_009543; Note=No experimental confirmation available.; |
| Function | Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Similarity | Belongs to the PIGU family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
| Subunit | Forms a complex with PIGK/GPI8, PIGS, PIGT and GPAA1/GAA1. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006763 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17998700 | RefSeq | NP_536724 | 435 | phosphatidylinositol glycan anchor biosynthesis class U protein precursor |
Identical Sequences to LMP006763 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17998700 | GenBank | JAA10214.1 | 435 | phosphatidylinositol glycan anchor biosynthesis, class U [Pan troglodytes] |
| GI:17998700 | GenBank | JAA14966.1 | 435 | phosphatidylinositol glycan anchor biosynthesis, class U [Pan troglodytes] |
| GI:17998700 | GenBank | JAA30580.1 | 435 | phosphatidylinositol glycan anchor biosynthesis, class U [Pan troglodytes] |
| GI:17998700 | GenBank | JAA33308.1 | 435 | phosphatidylinositol glycan anchor biosynthesis, class U [Pan troglodytes] |
| GI:17998700 | RefSeq | XP_003831872.1 | 435 | PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Pan paniscus] |
| GI:17998700 | RefSeq | XP_004062087.1 | 435 | PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform 1 [Gorilla gorilla gorilla] |
Related Sequences to LMP006763 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17998700 | GenBank | ABL24054.1 | 435 | Sequence 228 from patent US 7129338 |
| GI:17998700 | GenBank | EHH19761.1 | 435 | GPI transamidase component PIG-U [Macaca mulatta] |
| GI:17998700 | RefSeq | XP_001104089.1 | 435 | PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform 2 [Macaca mulatta] |
| GI:17998700 | RefSeq | XP_005568840.1 | 435 | PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform X2 [Macaca fascicularis] |
| GI:17998700 | RefSeq | XP_008019617.1 | 435 | PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Chlorocebus sabaeus] |
| GI:17998700 | RefSeq | XP_010384804.1 | 435 | PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein isoform X1 [Rhinopithecus roxellana] |