Gene/Proteome Database (LMPD)
LMPD ID
LMP006764
Gene ID
Species
Homo sapiens (Human)
Gene Name
patatin-like phospholipase domain containing 4
Gene Symbol
Synonyms
DXS1283E; GS2; iPLA2eta
Alternate Names
patatin-like phospholipase domain-containing protein 4; IPLA2 eta; calcium independent phospholipases A2 eta
Chromosome
X
Map Location
Xp22.3
EC Number
3.1.1.3
Summary
This gene encodes a member of the patatin-like family of phospholipases. The encoded enzyme has both triacylglycerol lipase and transacylase activities and may be involved in adipocyte triglyceride homeostasis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome Y. [provided by RefSeq, Feb 2010]
Orthologs
Proteins
patatin-like phospholipase domain-containing protein 4 isoform 1 precursor | |
---|---|
Refseq ID | NP_001135861 |
Protein GI | 215422355 |
UniProt ID | P41247 |
mRNA ID | NM_001142389 |
Length | 253 |
RefSeq Status | REVIEWED |
MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE |
patatin-like phospholipase domain-containing protein 4 isoform 1 precursor | |
---|---|
Refseq ID | NP_004641 |
Protein GI | 42415471 |
UniProt ID | P41247 |
mRNA ID | NM_004650 |
Length | 253 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:215422355 (mRNA isoform) | |
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2493 peptide sequence: MKHINLSFAACGFLGIYHLGAASA sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2493 peptide sequence: MKHINLSFAACGFLGIYHLGAASA |
patatin-like phospholipase domain-containing protein 4 isoform 2 | |
---|---|
Refseq ID | NP_001166143 |
Protein GI | 291045302 |
UniProt ID | P41247 |
mRNA ID | NM_001172672 |
Length | 166 |
RefSeq Status | REVIEWED |
MARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE |
Gene Information
Entrez Gene ID
Gene Name
patatin-like phospholipase domain containing 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0004806 | IEA:UniProtKB-EC | F | triglyceride lipase activity |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
KEGG Pathway Links
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
LIPAS-PWY | triacylglycerol degradation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
patatin-like phospholipase domain containing 4
Protein Entry
PLPL4_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P41247-1; Sequence=Displayed; Name=2; IsoId=P41247-2; Sequence=VSP_043089; Note=No experimental confirmation available.; |
Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. |
Function | Lipid hydrolase. |
Similarity | Contains 1 patatin domain. |
Tissue Specificity | Expressed in all tissues examined, including heart, brain, placenta, lung, liver, muscle, kidney, pancreas and spleen. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006764 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
215422355 | RefSeq | NP_001135861 | 253 | patatin-like phospholipase domain-containing protein 4 isoform 1 precursor |
291045302 | RefSeq | NP_001166143 | 166 | patatin-like phospholipase domain-containing protein 4 isoform 2 |
Identical Sequences to LMP006764 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:215422355 | DBBJ | BAF82577.1 | 253 | unnamed protein product [Homo sapiens] |
GI:291045302 | DBBJ | BAG65374.1 | 166 | unnamed protein product [Homo sapiens] |
GI:215422355 | GenBank | EAW98753.1 | 253 | patatin-like phospholipase domain containing 4, isoform CRA_b [Homo sapiens] |
GI:215422355 | GenBank | ACM97580.1 | 253 | Sequence 7 from patent US 7473541 |
GI:215422355 | GenBank | AEU43490.1 | 253 | Sequence 239 from patent US 8052970 |
GI:215422355 | GenBank | AEU43519.1 | 253 | Sequence 268 from patent US 8052970 |
GI:215422355 | GenBank | AHD78237.1 | 253 | Sequence 25574 from patent US 8586006 |
Related Sequences to LMP006764 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:291045302 | GenBank | AAA16491.1 | 253 | a gene isolated from a CpG island between STS and KAL [Homo sapiens] |
GI:291045302 | GenBank | AAA17838.1 | 253 | unknown [Homo sapiens] |
GI:291045302 | GenBank | EAW98752.1 | 253 | patatin-like phospholipase domain containing 4, isoform CRA_b [Homo sapiens] |
GI:291045302 | GenBank | AEU43490.1 | 253 | Sequence 239 from patent US 8052970 |
GI:291045302 | GenBank | AEU43519.1 | 253 | Sequence 268 from patent US 8052970 |
GI:215422355 | GenBank | JAA02641.1 | 253 | patatin-like phospholipase domain containing 4 [Pan troglodytes] |
GI:215422355 | GenBank | JAA23324.1 | 253 | patatin-like phospholipase domain containing 4 [Pan troglodytes] |
GI:215422355 | RefSeq | XP_001139947.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 [Pan troglodytes] |
GI:215422355 | RefSeq | XP_008958364.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 [Pan paniscus] |
GI:215422355 | RefSeq | XP_009437015.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 [Pan troglodytes] |
GI:215422355 | RefSeq | XP_009437016.1 | 253 | PREDICTED: patatin-like phospholipase domain-containing protein 4 [Pan troglodytes] |
GI:291045302 | SwissProt | P41247.3 | 253 | RecName: Full=Patatin-like phospholipase domain-containing protein 4; AltName: Full=Protein GS2 [Homo sapiens] |