Gene/Proteome Database (LMPD)
LMPD ID
LMP006774
Gene ID
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group XVI
Gene Symbol
Synonyms
AdPLA; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3
Alternate Names
HRAS-like suppressor 3; adipose-specific PLA2; HRAS-like suppressor 1; H-rev 107 protein homolog; group XVI phospholipase A2; group XVI phospholipase A1/A2; Ca-independent phospholipase A1/2; adipose-specific phospholipase A2; renal carcinoma antigen NY-REN-65
Chromosome
11
Map Location
11q12.3
EC Number
3.1.1.32
Proteins
| HRAS-like suppressor 3 | |
|---|---|
| Refseq ID | NP_009000 |
| Protein GI | 189571618 |
| UniProt ID | P53816 |
| mRNA ID | NM_007069 |
| Length | 162 |
| RefSeq Status | VALIDATED |
| MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ | |
| HRAS-like suppressor 3 | |
|---|---|
| Refseq ID | NP_001121675 |
| Protein GI | 189571621 |
| UniProt ID | P53816 |
| mRNA ID | NM_001128203 |
| Length | 162 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:189571618 (mRNA isoform) | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
| GO:0052740 | IEA:UniProtKB-EC | F | 1-acyl-2-lysophosphatidylserine acylhydrolase activity |
| GO:0008970 | IEA:UniProtKB-EC | F | phosphatidylcholine 1-acylhydrolase activity |
| GO:0052739 | IEA:UniProtKB-EC | F | phosphatidylserine 1-acylhydrolase activity |
| GO:0004623 | IDA:UniProtKB | F | phospholipase A2 activity |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0045786 | IEA:Ensembl | P | negative regulation of cell cycle |
| GO:0036151 | TAS:Reactome | P | phosphatidylcholine acyl-chain remodeling |
| GO:0036152 | TAS:Reactome | P | phosphatidylethanolamine acyl-chain remodeling |
| GO:0036149 | TAS:Reactome | P | phosphatidylinositol acyl-chain remodeling |
| GO:0036150 | TAS:Reactome | P | phosphatidylserine acyl-chain remodeling |
| GO:0006644 | IDA:UniProtKB | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04014 | Ras signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_120829 | Acyl chain remodelling of PC |
| REACT_120722 | Acyl chain remodelling of PI |
| REACT_121384 | Acyl chain remodelling of PS |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007053 | LRAT-like domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=300 uM for dipalmitoyl-PC ; Vmax=2.57 umol/min/mg enzyme with dipalmitoyl-PC as substrate ; Vmax=267 nmol/min/mg enzyme with dipalmitoyl-PE as substrate ; pH dependence: Optimum pH is 9. ; |
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
| Catalytic Activity | Phosphatidylcholine + H(2)O = 2- acylglycerophosphocholine + a carboxylate. |
| Function | Exhibits PLA1/2 activity, catalyzing the calcium- independent hydrolysis of acyl groups in various phosphatidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue (By similarity). N- and O- acylation activity is hardly detectable. Might decrease protein phosphatase 2A (PP2A) activity. {ECO |
| Induction | By IFNG and IRF1. |
| Interaction | P30153:PPP2R1A; NbExp=7; IntAct=EBI-746318, EBI-302388; |
| Similarity | Belongs to the H-rev107 family. |
| Subcellular Location | Cytoplasm. Cytoplasm, perinuclear region . Membrane; Single-pass membrane protein. |
| Subunit | Interacts with PPP2R1A; this interaction might decrease PP2A activity. |
| Tissue Specificity | Widely expressed. low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down- regulated in some ovarian carcinomas and testicular germ cell tumors. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006774 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 189571618 | RefSeq | NP_009000 | 162 | HRAS-like suppressor 3 |
Identical Sequences to LMP006774 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:189571618 | GenBank | JAA22613.1 | 162 | phospholipase A2, group XVI [Pan troglodytes] |
| GI:189571618 | GenBank | JAA33330.1 | 162 | phospholipase A2, group XVI [Pan troglodytes] |
| GI:189571618 | GenBank | AIC50819.1 | 162 | PLA2G16, partial [synthetic construct] |
| GI:189571618 | RefSeq | XP_004051456.1 | 162 | PREDICTED: group XVI phospholipase A1/A2 [Gorilla gorilla gorilla] |
| GI:189571618 | RefSeq | XP_006718489.1 | 162 | PREDICTED: HRAS-like suppressor 3 isoform X1 [Homo sapiens] |
| GI:189571618 | RefSeq | XP_008952176.1 | 162 | PREDICTED: HRAS-like suppressor 3 [Pan paniscus] |
Related Sequences to LMP006774 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:189571618 | DBBJ | BAH08749.1 | 162 | Ca-independent phospholipase A1/2 [Homo sapiens] |
| GI:189571618 | EMBL | CAA63423.1 | 162 | orf [Homo sapiens] |
| GI:189571618 | GenBank | AAM17210.1 | 162 | Sequence 3 from patent US 6359123 |
| GI:189571618 | RefSeq | NP_001128980.1 | 162 | HRAS-like suppressor 3 [Pongo abelii] |
| GI:189571618 | RefSeq | XP_003274179.1 | 162 | PREDICTED: group XVI phospholipase A1/A2 [Nomascus leucogenys] |
| GI:189571618 | SwissProt | Q5R611.1 | 162 | RecName: Full=HRAS-like suppressor 3; Short=HRSL3; AltName: Full=Group XVI phospholipase A1/A2; AltName: Full=H-rev 107 protein homolog [Pongo abelii] |