Gene/Proteome Database (LMPD)

LMPD ID
LMP006774
Gene ID
11145
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group XVI
Gene Symbol
PLA2G16
Synonyms
AdPLA; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3
Alternate Names
HRAS-like suppressor 3; adipose-specific PLA2; HRAS-like suppressor 1; H-rev 107 protein homolog; group XVI phospholipase A2; group XVI phospholipase A1/A2; Ca-independent phospholipase A1/2; adipose-specific phospholipase A2; renal carcinoma antigen NY-REN-65
Chromosome
11
Map Location
11q12.3
EC Number
3.1.1.32

Proteins

HRAS-like suppressor 3
Refseq ID NP_009000
Protein GI 189571618
UniProt ID P53816
mRNA ID NM_007069
Length 162
RefSeq Status VALIDATED
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
HRAS-like suppressor 3
Refseq ID NP_001121675
Protein GI 189571621
UniProt ID P53816
mRNA ID NM_001128203
Length 162
RefSeq Status VALIDATED
Protein sequence is identical to GI:189571618 (mRNA isoform)

Gene Information

Entrez Gene ID
11145
Gene Name
phospholipase A2, group XVI
Gene Symbol
PLA2G16
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0052740 IEA:UniProtKB-EC F 1-acyl-2-lysophosphatidylserine acylhydrolase activity
GO:0008970 IEA:UniProtKB-EC F phosphatidylcholine 1-acylhydrolase activity
GO:0052739 IEA:UniProtKB-EC F phosphatidylserine 1-acylhydrolase activity
GO:0004623 IDA:UniProtKB F phospholipase A2 activity
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0045786 IEA:Ensembl P negative regulation of cell cycle
GO:0036151 TAS:Reactome P phosphatidylcholine acyl-chain remodeling
GO:0036152 TAS:Reactome P phosphatidylethanolamine acyl-chain remodeling
GO:0036149 TAS:Reactome P phosphatidylinositol acyl-chain remodeling
GO:0036150 TAS:Reactome P phosphatidylserine acyl-chain remodeling
GO:0006644 IDA:UniProtKB P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04014 Ras signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_120829 Acyl chain remodelling of PC
REACT_120722 Acyl chain remodelling of PI
REACT_121384 Acyl chain remodelling of PS

Domain Information

InterPro Annotations

Accession Description
IPR007053 LRAT-like domain

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group XVI
Protein Entry
HRSL3_HUMAN
UniProt ID
P53816
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=300 uM for dipalmitoyl-PC ; Vmax=2.57 umol/min/mg enzyme with dipalmitoyl-PC as substrate ; Vmax=267 nmol/min/mg enzyme with dipalmitoyl-PE as substrate ; pH dependence: Optimum pH is 9. ;
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate.
Catalytic Activity Phosphatidylcholine + H(2)O = 2- acylglycerophosphocholine + a carboxylate.
Function Exhibits PLA1/2 activity, catalyzing the calcium- independent hydrolysis of acyl groups in various phosphatidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue (By similarity). N- and O- acylation activity is hardly detectable. Might decrease protein phosphatase 2A (PP2A) activity. {ECO
Induction By IFNG and IRF1.
Interaction P30153:PPP2R1A; NbExp=7; IntAct=EBI-746318, EBI-302388;
Similarity Belongs to the H-rev107 family.
Subcellular Location Cytoplasm. Cytoplasm, perinuclear region . Membrane; Single-pass membrane protein.
Subunit Interacts with PPP2R1A; this interaction might decrease PP2A activity.
Tissue Specificity Widely expressed. low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down- regulated in some ovarian carcinomas and testicular germ cell tumors. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP006774 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
189571618 RefSeq NP_009000 162 HRAS-like suppressor 3

Identical Sequences to LMP006774 proteins

Reference Database Accession Length Protein Name
GI:189571618 GenBank JAA22613.1 162 phospholipase A2, group XVI [Pan troglodytes]
GI:189571618 GenBank JAA33330.1 162 phospholipase A2, group XVI [Pan troglodytes]
GI:189571618 GenBank AIC50819.1 162 PLA2G16, partial [synthetic construct]
GI:189571618 RefSeq XP_004051456.1 162 PREDICTED: group XVI phospholipase A1/A2 [Gorilla gorilla gorilla]
GI:189571618 RefSeq XP_006718489.1 162 PREDICTED: HRAS-like suppressor 3 isoform X1 [Homo sapiens]
GI:189571618 RefSeq XP_008952176.1 162 PREDICTED: HRAS-like suppressor 3 [Pan paniscus]

Related Sequences to LMP006774 proteins

Reference Database Accession Length Protein Name
GI:189571618 DBBJ BAH08749.1 162 Ca-independent phospholipase A1/2 [Homo sapiens]
GI:189571618 EMBL CAA63423.1 162 orf [Homo sapiens]
GI:189571618 GenBank AAM17210.1 162 Sequence 3 from patent US 6359123
GI:189571618 RefSeq NP_001128980.1 162 HRAS-like suppressor 3 [Pongo abelii]
GI:189571618 RefSeq XP_003274179.1 162 PREDICTED: group XVI phospholipase A1/A2 [Nomascus leucogenys]
GI:189571618 SwissProt Q5R611.1 162 RecName: Full=HRAS-like suppressor 3; Short=HRSL3; AltName: Full=Group XVI phospholipase A1/A2; AltName: Full=H-rev 107 protein homolog [Pongo abelii]