Gene/Proteome Database (LMPD)
LMPD ID
LMP006778
Gene ID
Species
Homo sapiens (Human)
Gene Name
lipase maturation factor 1
Gene Symbol
Synonyms
C16orf26; HMFN1876; JFP11; TMEM112; TMEM112A
Chromosome
16
Map Location
16p13.3
Summary
The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2010]
Orthologs
Proteins
lipase maturation factor 1 | |
---|---|
Refseq ID | NP_073610 |
Protein GI | 115511024 |
UniProt ID | Q96S06 |
mRNA ID | NM_022773 |
Length | 567 |
RefSeq Status | REVIEWED |
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLETGFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDFHYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQAVLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFGSVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVILQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRGWPLPGPL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IEA:Ensembl | C | endoplasmic reticulum membrane |
GO:0006888 | IEA:Ensembl | P | ER to Golgi vesicle-mediated transport |
GO:0034382 | IEA:Ensembl | P | chylomicron remnant clearance |
GO:0051006 | IEA:Ensembl | P | positive regulation of lipoprotein lipase activity |
GO:0033578 | IEA:Ensembl | P | protein glycosylation in Golgi |
GO:0051604 | IEA:Ensembl | P | protein maturation |
GO:0009306 | IEA:Ensembl | P | protein secretion |
GO:0090181 | IEA:Ensembl | P | regulation of cholesterol metabolic process |
GO:0090207 | IEA:Ensembl | P | regulation of triglyceride metabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR009613 | Lipase maturation factor |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Caution | Lacks conserved residue(s) required for the propagation of feature annotation. |
Function | Involved in the maturation of specific proteins in the endoplasmic reticulum. |
Similarity | Belongs to the lipase maturation factor family. |
Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP006778 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
115511024 | RefSeq | NP_073610 | 567 | lipase maturation factor 1 |
Identical Sequences to LMP006778 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:115511024 | GenBank | AAK61259.1 | 567 | possible integral membrane [Homo sapiens] |
GI:115511024 | GenBank | EAW85696.1 | 567 | hypothetical protein FLJ12681, isoform CRA_a [Homo sapiens] |
GI:115511024 | GenBank | AAI56646.1 | 567 | Lipase maturation factor 1 [synthetic construct] |
GI:115511024 | SwissProt | Q96S06.1 | 567 | RecName: Full=Lipase maturation factor 1; AltName: Full=Transmembrane protein 112 [Homo sapiens] |
Related Sequences to LMP006778 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:115511024 | DBBJ | BAB14218.1 | 567 | unnamed protein product [Homo sapiens] |
GI:115511024 | DBBJ | BAD38655.1 | 563 | putative protein product of HMFN1876, partial [Homo sapiens] |
GI:115511024 | EMBL | CAE90628.1 | 567 | unnamed protein product [Homo sapiens] |
GI:115511024 | EMBL | CAH05577.1 | 567 | unnamed protein product [Homo sapiens] |
GI:115511024 | GenBank | JAA00896.1 | 567 | lipase maturation factor 1 [Pan troglodytes] |
GI:115511024 | RefSeq | XP_009428318.1 | 567 | PREDICTED: lipase maturation factor 1 [Pan troglodytes] |