Gene/Proteome Database (LMPD)

LMPD ID
LMP006778
Gene ID
Species
Homo sapiens (Human)
Gene Name
lipase maturation factor 1
Gene Symbol
Synonyms
C16orf26; HMFN1876; JFP11; TMEM112; TMEM112A
Chromosome
16
Map Location
16p13.3
Summary
The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2010]
Orthologs

Proteins

lipase maturation factor 1
Refseq ID NP_073610
Protein GI 115511024
UniProt ID Q96S06
mRNA ID NM_022773
Length 567
RefSeq Status REVIEWED
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLETGFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDFHYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQAVLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFGSVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVILQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRGWPLPGPL

Gene Information

Entrez Gene ID
Gene Name
lipase maturation factor 1
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IEA:Ensembl C endoplasmic reticulum membrane
GO:0006888 IEA:Ensembl P ER to Golgi vesicle-mediated transport
GO:0034382 IEA:Ensembl P chylomicron remnant clearance
GO:0051006 IEA:Ensembl P positive regulation of lipoprotein lipase activity
GO:0033578 IEA:Ensembl P protein glycosylation in Golgi
GO:0051604 IEA:Ensembl P protein maturation
GO:0009306 IEA:Ensembl P protein secretion
GO:0090181 IEA:Ensembl P regulation of cholesterol metabolic process
GO:0090207 IEA:Ensembl P regulation of triglyceride metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR009613 Lipase maturation factor

UniProt Annotations

Entry Information

Gene Name
lipase maturation factor 1
Protein Entry
LMF1_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Caution Lacks conserved residue(s) required for the propagation of feature annotation.
Function Involved in the maturation of specific proteins in the endoplasmic reticulum.
Similarity Belongs to the lipase maturation factor family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP006778 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
115511024 RefSeq NP_073610 567 lipase maturation factor 1

Identical Sequences to LMP006778 proteins

Reference Database Accession Length Protein Name
GI:115511024 GenBank AAK61259.1 567 possible integral membrane [Homo sapiens]
GI:115511024 GenBank EAW85696.1 567 hypothetical protein FLJ12681, isoform CRA_a [Homo sapiens]
GI:115511024 GenBank AAI56646.1 567 Lipase maturation factor 1 [synthetic construct]
GI:115511024 SwissProt Q96S06.1 567 RecName: Full=Lipase maturation factor 1; AltName: Full=Transmembrane protein 112 [Homo sapiens]

Related Sequences to LMP006778 proteins

Reference Database Accession Length Protein Name
GI:115511024 DBBJ BAB14218.1 567 unnamed protein product [Homo sapiens]
GI:115511024 DBBJ BAD38655.1 563 putative protein product of HMFN1876, partial [Homo sapiens]
GI:115511024 EMBL CAE90628.1 567 unnamed protein product [Homo sapiens]
GI:115511024 EMBL CAH05577.1 567 unnamed protein product [Homo sapiens]
GI:115511024 GenBank JAA00896.1 567 lipase maturation factor 1 [Pan troglodytes]
GI:115511024 RefSeq XP_009428318.1 567 PREDICTED: lipase maturation factor 1 [Pan troglodytes]