Gene/Proteome Database (LMPD)
Proteins
| glycolipid transfer protein domain-containing protein 2 precursor | |
|---|---|
| Refseq ID | NP_001014985 |
| Protein GI | 304571945 |
| UniProt ID | NONE |
| mRNA ID | NM_001014985 |
| Length | 291 |
| RefSeq Status | VALIDATED |
| MGVAARPPALRHWFSHSIPLAIFALLLLYLSVRSLGARSGCGPRAQPCVPGETAPFQVRQESGTLEAPERKQPPCLGPRGMLGRMMRRFHASLKPEGDVGLSPYLAGWRALVEFLTPLGSVFAFATREAFTKVTDLEARVHGPDAEHYWSLVAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRVATGALGGPEAGVQCSDAYRAALGPHHPWLVRQTARLAFLAFPGRRRLLELACPGATEAEARAALLRAAGTLEDVYNRTQSLLAERGLLQLA | |
| sig_peptide: 1..36 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3975 peptide sequence: MGVAARPPALRHWFSHSIPLAIFALLLLYLSVRSLG | |
Gene Information
Entrez Gene ID
Gene Name
glycolipid transfer protein domain containing 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:InterPro | C | cytoplasm |
| GO:0051861 | IEA:InterPro | F | glycolipid binding |
| GO:0017089 | IEA:InterPro | F | glycolipid transporter activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR014830 | Glycolipid transfer protein domain |
UniProt Annotations
Entry Information
Gene Name
glycolipid transfer protein domain containing 2
Protein Entry
NONE_CAEEL
UniProt ID
Species
Human
Identical and Related Proteins
Unique RefSeq proteins for LMP006789 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 304571945 | RefSeq | NP_001014985 | 291 | glycolipid transfer protein domain-containing protein 2 precursor |
Identical Sequences to LMP006789 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006789 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:304571945 | GenBank | EAW90408.1 | 291 | hypothetical LOC388323 [Homo sapiens] |
| GI:304571945 | GenBank | AHD76266.1 | 291 | Sequence 19539 from patent US 8586006 |
| GI:304571945 | RefSeq | XP_523554.2 | 291 | PREDICTED: glycolipid transfer protein domain-containing protein 2 isoform X2 [Pan troglodytes] |
| GI:304571945 | RefSeq | XP_003810247.1 | 291 | PREDICTED: glycolipid transfer protein domain-containing protein 2 [Pan paniscus] |
| GI:304571945 | RefSeq | XP_005256683.1 | 327 | PREDICTED: glycolipid transfer protein domain-containing protein 2 isoform X1 [Homo sapiens] |
| GI:304571945 | SwissProt | A6NH11.2 | 291 | RecName: Full=Glycolipid transfer protein domain-containing protein 2 [Homo sapiens] |