Gene/Proteome Database (LMPD)
LMPD ID
LMP006790
Gene ID
Species
Homo sapiens (Human)
Gene Name
carbonyl reductase 1
Gene Symbol
Synonyms
CBR; SDR21C1; hCBR1
Alternate Names
carbonyl reductase [NADPH] 1; carbonyl reductase (NADPH) 1; prostaglandin 9-ketoreductase; prostaglandin-E(2) 9-reductase; NADPH-dependent carbonyl reductase 1; 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 21C, member 1
Chromosome
21
Map Location
21q22.13
EC Number
1.1.1.184
Summary
The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]
Orthologs
Proteins
| carbonyl reductase [NADPH] 1 isoform 1 | |
|---|---|
| Refseq ID | NP_001748 |
| Protein GI | 4502599 |
| UniProt ID | P16152 |
| mRNA ID | NM_001757 |
| Length | 277 |
| RefSeq Status | REVIEWED |
| MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW | |
| carbonyl reductase [NADPH] 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001273718 |
| Protein GI | 557948119 |
| UniProt ID | P16152 |
| mRNA ID | NM_001286789 |
| Length | 173 |
| RefSeq Status | REVIEWED |
| MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQASCVLSAWSCLSQNPSGGKSKPLAWFTEMSIICRCLTLGPF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0031982 | IDA:UniProtKB | C | vesicle |
| GO:0047021 | IEA:UniProtKB-EC | F | 15-hydroxyprostaglandin dehydrogenase (NADP+) activity |
| GO:0004090 | IDA:UniProtKB | F | carbonyl reductase (NADPH) activity |
| GO:0016655 | IDA:UniProtKB | F | oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor |
| GO:0050221 | IEA:UniProtKB-EC | F | prostaglandin-E2 9-reductase activity |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0019371 | TAS:Reactome | P | cyclooxygenase pathway |
| GO:0017144 | IDA:UniProtKB | P | drug metabolic process |
| GO:0030855 | IEP:UniProt | P | epithelial cell differentiation |
| GO:0055114 | IDA:UniProtKB | P | oxidation-reduction process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0042373 | IDA:UniProtKB | P | vitamin K metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00590 | Arachidonic acid metabolism |
| hsa05204 | Chemical carcinogenesis |
| hsa00980 | Metabolism of xenobiotics by cytochrome P450 |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150149 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P16152-1; Sequence=Displayed; Name=2; IsoId=P16152-2; Sequence=VSP_054796, VSP_054797; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=30 uM for S-nitrosoglutathione {ECO |
| Catalytic Activity | (13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprost- 13-enoate + NADP(+) = (13E)-11-alpha-hydroxy-9,15-dioxoprost-13- enoate + NADPH. |
| Catalytic Activity | (5Z,13E)-(15S)-9-alpha,11-alpha,15- trihydroxyprosta-5,13-dienoate + NADP(+) = (5Z,13E)-(15S)-11- alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate + NADPH. |
| Catalytic Activity | R-CHOH-R' + NADP(+) = R-CO-R' + NADPH. |
| Enzyme Regulation | Inhibited by quercetin, rutenin and its derivatives. {ECO |
| Function | NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. {ECO |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Monomer. {ECO |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/cbr1/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP006790 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4502599 | RefSeq | NP_001748 | 277 | carbonyl reductase [NADPH] 1 isoform 1 |
| 557948119 | RefSeq | NP_001273718 | 173 | carbonyl reductase [NADPH] 1 isoform 2 |
Identical Sequences to LMP006790 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:557948119 | DBBJ | BAG57468.1 | 173 | unnamed protein product [Homo sapiens] |
| GI:557948119 | GenBank | EAX09754.1 | 173 | carbonyl reductase 1, isoform CRA_c [Homo sapiens] |
| GI:4502599 | GenBank | JAA06113.1 | 277 | carbonyl reductase 1 [Pan troglodytes] |
| GI:4502599 | GenBank | JAA18303.1 | 277 | carbonyl reductase 1 [Pan troglodytes] |
| GI:4502599 | GenBank | JAA29588.1 | 277 | carbonyl reductase 1 [Pan troglodytes] |
| GI:4502599 | GenBank | JAA44177.1 | 277 | carbonyl reductase 1 [Pan troglodytes] |
| GI:4502599 | GenBank | AIC48430.1 | 277 | CBR1, partial [synthetic construct] |
| GI:4502599 | RefSeq | XP_004062803.1 | 277 | PREDICTED: carbonyl reductase [NADPH] 1 [Gorilla gorilla gorilla] |
Related Sequences to LMP006790 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:557948119 | DBBJ | BAA33498.1 | 277 | carbonyl reductase [Homo sapiens] |
| GI:4502599 | GenBank | AAV38645.1 | 278 | carbonyl reductase 1, partial [synthetic construct] |
| GI:4502599 | GenBank | AAX37066.1 | 278 | carbonyl reductase 1, partial [synthetic construct] |
| GI:4502599 | GenBank | AAX42735.1 | 278 | carbonyl reductase 1, partial [synthetic construct] |
| GI:557948119 | GenBank | ABM83279.1 | 277 | carbonyl reductase 1 [synthetic construct] |
| GI:557948119 | GenBank | ABM86485.1 | 277 | carbonyl reductase 1, partial [synthetic construct] |
| GI:4502599 | GenBank | ACM85544.1 | 308 | Sequence 11042 from patent US 6812339 |
| GI:4502599 | GenBank | AEI19259.1 | 276 | Sequence 588 from patent US 7960100 |
| GI:4502599 | GenBank | AEN36272.1 | 276 | Sequence 2200 from patent US 7998689 |
| GI:557948119 | RefSeq | XP_003824009.1 | 277 | PREDICTED: carbonyl reductase [NADPH] 1 [Pan paniscus] |
| GI:557948119 | RefSeq | XP_008984891.1 | 173 | PREDICTED: carbonyl reductase [NADPH] 1 isoform X2 [Callithrix jacchus] |
| GI:557948119 | RefSeq | XP_009457585.1 | 222 | PREDICTED: carbonyl reductase [NADPH] 1 isoform X2 [Pan troglodytes] |