Gene/Proteome Database (LMPD)
Proteins
| Sdp1p | |
|---|---|
| Refseq ID | NP_012153 |
| Protein GI | 6322078 |
| UniProt ID | P40479 |
| mRNA ID | NM_001179461 |
| Length | 209 |
| MNIYTSPTRTPNIAPKSGQRPSLPMLATDERSTDKESPNEDREFVPCSSLDVRRIYPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKTNVQANSYRKVP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:SGD | C | cytoplasm |
| GO:0005634 | IDA:SGD | C | nucleus |
| GO:0033550 | IDA:SGD | F | MAP kinase tyrosine phosphatase activity |
| GO:0008138 | IEA:InterPro | F | protein tyrosine/serine/threonine phosphatase activity |
| GO:0000196 | IGI:SGD | P | MAPK cascade involved in cell wall organization or biogenesis |
| GO:0000200 | IMP:SGD | P | inactivation of MAPK activity involved in cell wall organization or biogenesis |
| GO:1990264 | IDA:GOC | P | peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024950 | Dual specificity phosphatase |
| IPR000340 | Dual specificity phosphatase, catalytic domain |
| IPR020422 | Dual specificity phosphatase, subgroup, catalytic domain |
| IPR016130 | Protein-tyrosine phosphatase, active site |
| IPR029021 | Protein-tyrosine phosphatase-like |
| IPR000387 | Protein-tyrosine/Dual specificity phosphatase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate |
| Catalytic Activity | Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate. {ECO:0000255|PROSITE-ProRule:PRU10044}. |
| Function | Mediates dephosphorylation of MAPK substrates such as SLT2, acquiring enhanced catalytic activity under oxidative conditions. {ECO:0000269|PubMed:12220658, ECO:0000269|PubMed:17495930}. |
| Similarity | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily |
| Similarity | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006836 (as displayed in Record Overview)
Identical Sequences to LMP006836 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006836 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|