Gene/Proteome Database (LMPD)

LMPD ID
LMP006850
Gene ID
851421
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
phosphoprotein phosphatase 2A catalytic subunit PPH21
Gene Symbol
PPH21
Synonyms
-
Alternate Names
phosphoprotein phosphatase 2A catalytic subunit PPH21
Chromosome
IV
EC Number
3.1.3.16

Proteins

phosphoprotein phosphatase 2A catalytic subunit PPH21
Refseq ID NP_010147
Protein GI 6320067
UniProt ID P23594
mRNA ID NM_001180193
Length 369
RefSeq Status PROVISIONAL
MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSGIADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSVSRKTPDYFL

Gene Information

Entrez Gene ID
851421
Gene Name
phosphoprotein phosphatase 2A catalytic subunit PPH21
Gene Symbol
PPH21
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000159 IDA:SGD C protein phosphatase type 2A complex
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004722 IMP:SGD F protein serine/threonine phosphatase activity
GO:0000082 IGI:SGD P G1/S transition of mitotic cell cycle
GO:0007015 TAS:SGD P actin filament organization
GO:0007117 TAS:SGD P budding cell bud growth
GO:0007094 IPI:SGD P mitotic spindle assembly checkpoint
GO:0006470 TAS:SGD P protein dephosphorylation
GO:0006417 IPI:SGD P regulation of translation

KEGG Pathway Links

KEGG Pathway ID Description
sce04111 Cell cycle - yeast
sce04113 Meiosis - yeast
sce03015 mRNA surveillance pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5618419 ERKs are inactivated

Domain Information

InterPro Annotations

Accession Description
IPR004843 Calcineurin-like phosphoesterase domain, apaH type
IPR029052 Metallo-dependent phosphatase-like
IPR006186 Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase

UniProt Annotations

Entry Information

Gene Name
phosphoprotein phosphatase 2A catalytic subunit PPH21
Protein Entry
PP2A1_YEAST
UniProt ID
P23594
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 2 manganese ions per subunit. {ECO:0000250};
Function Exact function not known, phosphatase 2A performs an essential cellular function.
Interaction Q04372:TAP42; NbExp=6; IntAct=EBI-12745, EBI-18926;
Miscellaneous Present with 5620 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Ptm Reversibly methyl esterified on Leu-369 by leucine carboxyl methyltransferase 1 (PPM1) and protein phosphatase methylesterase 1 (PPE1). Carboxyl methylation influences the affinity of the catalytic subunit for the different regulatory subunits, thereby modulating the PP2A holoenzyme's substrate specificity, enzyme activity and cellular localization. {ECO:0000269|PubMed:11060018, ECO:0000269|PubMed:11697862}.
Similarity Belongs to the PPP phosphatase family. PP-2A subfamily. {ECO:0000305}.
Subunit Inactivated in a complex with phosphatase methylesterase PPE1 (PP2Ai). Interacts with phosphatase 2A activator RRD2, which can reactivate PP2Ai by dissociating the catalytic subunit from the complex. Forms a ternary complex with RRD2-TAP42. {ECO:0000269|PubMed:14551259, ECO:0000269|PubMed:15447631, ECO:0000269|PubMed:15689491}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006850 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6320067 RefSeq NP_010147 369 phosphoprotein phosphatase 2A catalytic subunit PPH21

Identical Sequences to LMP006850 proteins

Reference Database Accession Length Protein Name
GI:6320067 GenBank EGA83648.1 369 Pph21p [Saccharomyces cerevisiae Lalvin QA23]
GI:6320067 GenBank EHN08210.1 369 Pph21p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6320067 GenBank EIW11071.1 369 Pph21p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6320067 GenBank EWG96871.1 369 Pph21p [Saccharomyces cerevisiae R103]
GI:6320067 gnl McCuskerlabDuke 369 Pph21p [Saccharomyces cerevisiae YJM993]
GI:6320067 Third Party Genbank DAA11724.1 369 TPA: phosphoprotein phosphatase 2A catalytic subunit PPH21 [Saccharomyces cerevisiae S288c]

Related Sequences to LMP006850 proteins

Reference Database Accession Length Protein Name
GI:6320067 DBBJ GAA22113.1 369 K7_Pph21p [Saccharomyces cerevisiae Kyokai no. 7]
GI:6320067 GenBank EGA62727.1 361 Pph21p [Saccharomyces cerevisiae FostersO]
GI:6320067 GenBank EGA79648.1 361 Pph21p [Saccharomyces cerevisiae Vin13]
GI:6320067 GenBank EGA87624.1 361 Pph21p [Saccharomyces cerevisiae VL3]
GI:6320067 GenBank EHN03397.1 369 Pph21p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6320067 GenBank EJT44608.1 369 PPH21-like protein [Saccharomyces kudriavzevii IFO 1802]